KEGG   Burkholderia xenovorans: Bxe_C1282Help
Entry
Bxe_C1282         CDS       T00340                                 

Definition
putative ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bxe  Burkholderia xenovorans
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Bxe_C1282
Enzymes [BR:bxe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Bxe_C1282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:1348188..1349225
Genome map
AA seq 345 aa AA seqDB search
MLSPVGGHRSRVLPASGTIGPSTFHALCMGTIVSIGSINLDLQMRVDHPVGSAETQRAHD
FSRLAGGKAANVAYLARRFGHDAQLLGMVGDDRFADEAVAPLRDLGIDVSRVRTAAGQPT
AVSMIFVPDNGKKTIVLASNANDAWQRADIDAALEAIDAAPAHSVLAVDCEMSVDACAAV
LAAAQRRALCVVLDPAPPQRAQSGALRALWRAVHALTPNEEEAAALTGIEIADQAGAVRA
ARALHREGFELVCVKRSDGGCIAVSRDGVLAVQVKPVEALDTTGAGDAFTGALAVSLVER
RAFADAVRLATAAANLTVMAWGSQTALPDRARADAFAAGLQCEWL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgctttcacccgttggcggacaccgttcgcgcgtgctgccggcctccggcaccatcggc
ccatcaacatttcacgcgctgtgtatgggaaccatcgtcagcatcggcagcatcaatctg
gacctgcaaatgcgcgtcgaccatccggtgggcagcgccgaaacgcagcgcgcccatgac
ttctcgcgcctcgccggcggcaaggcggcgaacgtcgcctatctcgcgcgccgcttcggt
cacgacgcgcaactgctcgggatggtcggcgacgaccgtttcgccgacgaagccgttgcg
ccgttgcgggacctcggcatcgacgtgtcgcgggtgcgcacggccgccgggcagcccacc
gcggtatcgatgatcttcgtgcccgacaacggaaaaaagaccatcgtgctggcgtccaac
gcgaatgacgcgtggcagcgcgcggatatcgacgccgcgctggaagcgatcgatgccgct
cccgcgcacagcgtgcttgcggtggactgcgaaatgagcgtcgacgcgtgcgcggccgtg
ctcgctgctgcgcaacgccgcgcgctgtgcgtcgtgctcgaccccgcgcctccccaacgc
gcccagtcgggcgcgctgcgtgcgctttggcgcgctgtgcacgcgctgacgcctaatgag
gaagaagcggcggcgctcaccggcatcgagatcgcggatcaggccggcgccgtgcgcgcc
gctcgtgccctgcatcgtgaaggcttcgaacttgtgtgcgtgaagcgcagcgatggcggc
tgcattgccgtgtcgcgcgacggcgtgctggcggtgcaggtgaaaccggtcgaagcgctc
gacaccaccggcgcgggagacgccttcaccggcgcgctcgccgtatcgctcgtcgagcgc
cgcgcgttcgcggatgcggtccggctggcgacggccgccgccaacctcaccgtcatggcg
tggggctcgcaaaccgcattgccggatcgcgcccgtgcggacgcgttcgccgccggattg
cagtgcgaatggctttga

DBGET integrated database retrieval system