KEGG   Paraburkholderia xenovorans LB400: Bxe_C1354Help
Entry
Bxe_C1354         CDS       T00340                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate)O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bxe  Paraburkholderia xenovorans LB400
Brite
Enzymes [BR:bxe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Bxe_C1354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltransf_18 MTS RrnaAD Methyltransf_11 Methyltransf_32 GCD14 ACP_syn_III_C CMAS SAM_MT GidB PrmA Methyltransf_23 NUDIX-like TehB
Motif
Other DBs
NCBI-ProteinID: ABE37204
JGI: BxeC1354
UniProt: Q13FD5
Position
3:1429458..1430195
Genome map
AA seq 245 aa AA seqDB search
MTDFTEARERMVERQIARRGVVNPHVLAAMRRVPREEFVAADLREFAYEDTPLPIGNEQT
ISQPAIVAAMIDAAEVSPGERILDVGTGSGYAAAVAAAIAQHVDSIERHAGLVATAREVL
RRLQISNVTIHLGDGTVGLAEHAPYDAIIAAAGGPHVPDAWRRQLAVGGRIVMPVGRDPH
HQRLIKLVRRSEQDYDESWLGEVRFVPLVGEDAWPSMDGGARRAGSGFCRGRLRAIARAV
GVGCE
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacttcaccgaggcccgcgagcggatggtcgaacggcagatcgctcgccgcggc
gtggtcaatccccatgtactggccgcgatgcgtcgcgtgcctcgcgaggaattcgtggcc
gccgatctgcgggaattcgcgtacgaagatacgccgctgccgatcggcaacgaacagacc
atctcgcaacccgccatcgtcgcggcgatgatcgatgccgcggaagtgagtccaggcgag
cgcatcctcgacgtcggcaccggctcgggctatgccgcagcggttgccgcggcgatcgca
cagcacgtggactcgatcgaacgccacgccggacttgtcgccaccgctcgcgaagtcctg
cggcggctgcaaatttccaacgtgacgattcacctcggcgacggcaccgttggcctcgcg
gaacatgcaccgtacgacgcgatcattgcggcagccggcggcccccatgttcccgacgcg
tggcgcaggcaactcgccgtcggtggccggatcgtcatgccggtgggtcgcgatccccat
catcagcggctcatcaagctcgtgcgccgcagcgaacaggattatgacgagagctggctt
ggcgaagtgaggtttgtaccacttgtcggcgaagatgcgtggccgtcgatggacggcggc
gcgcggcgcgcgggaagcggcttttgccgcgggcggcttcgcgccattgcgcgggctgta
ggggtcggatgtgaatag

DBGET integrated database retrieval system