KEGG   Burkholderia xenovorans: Bxe_C1354Help
Entry
Bxe_C1354         CDS       T00340                                 

Definition
protein-L-isoaspartate(D-aspartate)O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bxe  Burkholderia xenovorans
Brite
Enzymes [BR:bxe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Bxe_C1354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:1429458..1430195
Genome map
AA seq 245 aa AA seqDB search
MTDFTEARERMVERQIARRGVVNPHVLAAMRRVPREEFVAADLREFAYEDTPLPIGNEQT
ISQPAIVAAMIDAAEVSPGERILDVGTGSGYAAAVAAAIAQHVDSIERHAGLVATAREVL
RRLQISNVTIHLGDGTVGLAEHAPYDAIIAAAGGPHVPDAWRRQLAVGGRIVMPVGRDPH
HQRLIKLVRRSEQDYDESWLGEVRFVPLVGEDAWPSMDGGARRAGSGFCRGRLRAIARAV
GVGCE
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacttcaccgaggcccgcgagcggatggtcgaacggcagatcgctcgccgcggc
gtggtcaatccccatgtactggccgcgatgcgtcgcgtgcctcgcgaggaattcgtggcc
gccgatctgcgggaattcgcgtacgaagatacgccgctgccgatcggcaacgaacagacc
atctcgcaacccgccatcgtcgcggcgatgatcgatgccgcggaagtgagtccaggcgag
cgcatcctcgacgtcggcaccggctcgggctatgccgcagcggttgccgcggcgatcgca
cagcacgtggactcgatcgaacgccacgccggacttgtcgccaccgctcgcgaagtcctg
cggcggctgcaaatttccaacgtgacgattcacctcggcgacggcaccgttggcctcgcg
gaacatgcaccgtacgacgcgatcattgcggcagccggcggcccccatgttcccgacgcg
tggcgcaggcaactcgccgtcggtggccggatcgtcatgccggtgggtcgcgatccccat
catcagcggctcatcaagctcgtgcgccgcagcgaacaggattatgacgagagctggctt
ggcgaagtgaggtttgtaccacttgtcggcgaagatgcgtggccgtcgatggacggcggc
gcgcggcgcgcgggaagcggcttttgccgcgggcggcttcgcgccattgcgcgggctgta
ggggtcggatgtgaatag

DBGET integrated database retrieval system