KEGG   Bacillus amyloliquefaciens XH7: BAXH7_00051Help
Entry
BAXH7_00051       CDS       T01836                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bxh00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
49787..50665
Genome map
AA seq 292 aa AA seqDB search
MKAMRILEKAPAKINLSLDVTSKRPDGYHEVEMIMTTIDLADRIELTELPENVIRVASHN
RFVPDDQRNLAYQAAKLLKERYQVKKGVSIMITKVIPVAAGLAGGSSDAAATLRGLNRLW
DLKLSVEELAELGAEIGSDVSFCVYGGTALATGRGEKIRHISAPPHCWVVLAKPTIGVST
AEVYRRLNLQQVRHPDVQAMIDAIEEKSFQKVCGQLGNVLESVTLNLHPEVAMIKNQMKR
FGADAVLMSGSGPTVFGLVQYESKVQRIYNGLRGFCDQVYAVRMIGEQNALD
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagctatgcgtattttagaaaaagcgccggccaaaatcaatctgtccctcgatgta
acgagtaaacgcccggatggttatcatgaagtggagatgatcatgacgacaattgatttg
gcagatcggattgaactgacagaactgcccgaaaacgtgatcagagtggcgtcgcataat
cgctttgttcccgatgatcagcggaatctggcttatcaggcagccaaactgctcaaagaa
cggtaccaagtcaaaaaaggcgtttctattatgattacaaaagtgatacctgtagcagca
gggcttgccggcggaagcagcgatgcagcagccacgctcagagggctgaacagactctgg
gatttaaagctttctgttgaagagctcgcggagcttggggctgaaatcggttcagacgtg
tccttctgtgtatacggcggaactgccctggcaacaggacgcggtgagaagatcaggcat
atcagtgctccgcctcattgctgggtcgtgcttgccaaaccgacgattggggtatcgact
gccgaagtgtaccgccggctgaacttgcagcaggttcggcatccggatgtacaagcgatg
attgacgcaattgaagaaaaaagtttccaaaaggtttgcggacaattaggaaacgtattg
gaatcggttacgctcaaccttcatcccgaggtggcgatgattaaaaatcaaatgaaacgc
ttcggcgctgacgcggtgttaatgagcggaagcggaccgactgtattcggtttggttcaa
tacgaatcaaaggtgcagcggatttataacgggttaagaggtttctgtgatcaggtgtac
gcggtgcggatgatcggcgaacagaatgctcttgattaa

DBGET integrated database retrieval system