KEGG   Bacillus amyloliquefaciens XH7: BAXH7_00082Help
Entry
BAXH7_00082       CDS       T01836                                 

Gene name
sul
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bxh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BAXH7_00082 (sul)
Enzymes [BR:bxh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     BAXH7_00082 (sul)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
81899..82756
Genome map
AA seq 285 aa AA seqDB search
MAQQTIEQPKLIHTKKGALSYKEKTLIMGILNVTPDSFSDGGKYDSTERALLHAAKMAEE
GAHIIDIGGESTRPGASLVSADEEMSRVIPAIERITSELDVPISIDTYKASVADEAVKAG
ASIINDIWGAKGDPDMASVAAAHSVPIILMHNRKERNYNDLIPDMLADLMESVKIAAEAG
VSDENMILDPGIGFAKSYEDNLAVMNKLEVFSGLGYPLLLATSRKRFIGRVLDLPPEERA
EGTGATVCLGVQKGCDIVRVHDVKQIARMTKMMDAMLNKGGAHHG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcaaacaattgaacagcctaaactgattcatacaaaaaaaggcgctctgtcc
tataaagagaagacactcattatggggatattaaatgtaacgccagactccttctctgac
ggcggtaaatacgacagtacggaaagagcgcttctccatgcggcgaagatggctgaagaa
ggggcgcacatcatagatatcggcggagaatcgacaaggcccggcgcatcactcgtgtcg
gctgatgaggaaatgtcacgtgtaatccccgccatagagcggatcacaagcgaactggac
gttccgatttcaattgatacgtacaaagcgtccgtagcagacgaagcggtcaaagcgggg
gcctccatcattaatgacatctggggggcgaaaggtgatcctgacatggcgtcagtagcc
gccgcacacagtgttccgattatcttaatgcataatcgcaaggagagaaactataacgat
ctgattcctgatatgctcgcagatttgatggaaagtgtaaaaattgccgcagaagccggc
gtttcagatgaaaacatgattctggatccggggatcggcttcgcgaaaagctatgaggac
aatctggctgtcatgaacaagctggaagtgttcagcgggttagggtatccgctgctcctc
gcgacatcgagaaaaagattcatcggccgtgtgcttgaccttcctcctgaagaacgtgcc
gaggggacgggagcgacggtatgccttggcgtccagaaaggctgcgacattgtgagggtg
cacgatgtcaagcagatcgcgagaatgactaagatgatggatgctatgttgaataaagga
ggcgcacatcatggataa

DBGET integrated database retrieval system