KEGG   Bacillus amyloliquefaciens XH7: BAXH7_00174Help
Entry
BAXH7_00174       CDS       T01836                                 

Gene name
ybbD
Definition
beta-hexosaminidase lipoprotein (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bxh00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BAXH7_00174 (ybbD)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BAXH7_00174 (ybbD)
Enzymes [BR:bxh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BAXH7_00174 (ybbD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(175984..177897)
Genome map
AA seq 637 aa AA seqDB search
MKLVISAVLLLFIVSGTHHASTKPDIPSQAEQAVSRMTLDEKLGQMLMPDFRNWQKKGQS
SPEALTQMNDEVAGLIQKYRFGGVILFAENVKNTEQTVRLTDAFQKASPDIPLLLSIDQE
GGIVTRLGEGTHFPGNMALGAARKTAYASQTGAIIGKELKALGINTNFAPVLDINNNPGN
PVIGVRSFSSDRDLTASLGLASMKAQQKQDVAAAVKHFPGHGDTDVDSHYGLPLVTHSQE
RLRQIELYPFRKAIQAGADMIMTAHVQFPAFDDTTYKSKLDGSDILVPATLSKKVMTHLL
REEMGFNGVIVTDALNMKAIADHFGQEEAVVMAVKAGVDIALMPAQVTSLQTENRFAQVL
SALKKAVQKGEIPLQQINKSAERIISLKIKRGIYPAPKETSLKKKVAKAKQTVGSKNHLK
AEKQIAERSVTVLQNKNRTLPFKPKKNSRVLIAAPYEDQTASMEQTIRQLIKKKKIRPVT
ISKMNFAERTFNDEDKKLVSDADYVITGSYVVKNDPVVNDGNIDDSVTDPGKWTTAFPRA
VMKSAQSNHKPFVLMSLRNPYDAANFEEAEALIAVYGFKGYADGQFLQPNIPAGIEAIFG
QTKPKGRLPVDIPSVTHPGTTLYPYGFGINLKTGKPL
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttgtcatctcagctgtattactgttgttcattgtttccggcacacatcatgca
tcgacaaaaccggacattccgtcacaggcggaacaagcggtatcccgcatgacattagat
gaaaaactggggcagatgctcatgcctgattttcgcaattggcaaaagaaggggcagtca
tcccctgaggctcttacccaaatgaatgacgaagtcgcagggcttattcaaaagtaccgg
ttcggcggcgttatcttatttgcagaaaatgtaaaaaacactgagcaaacggtccgcctg
acagatgcctttcaaaaagcgagtcctgatattccgcttttattaagcattgatcaagaa
ggcggcatcgtaacaagacttggtgaaggcactcatttcccaggcaatatggcgctcgga
gccgcgagaaaaacagcctatgcgtctcagaccggcgccataatcgggaaagaactgaag
gcacttggcattaatacgaatttcgctcccgttctcgatatcaataataatcccggaaat
ccggtcatcggcgtcaggtcattcagctcagaccgtgatctgacagcatcactcggcctt
gcctcaatgaaggctcagcaaaaacaggatgtcgctgccgccgtcaaacatttcccggga
cacggcgatacggatgtcgatagccactacggcctcccgcttgtcacccacagtcaagaa
aggctgcgtcagattgaactttatccgttccggaaagccattcaggccggggccgatatg
atcatgacagcccatgtgcaatttcccgcttttgacgatacaacttataaaagcaagctg
gacggttcagacatcctcgtaccagccactctctcgaaaaaagtgatgactcatcttctc
cgtgaggaaatgggatttaacggcgtcattgtcacggatgcattaaatatgaaagccatt
gccgatcatttcggccaggaagaggcggtcgtcatggccgtaaaagcaggagtcgatatc
gccctgatgccggcccaagtgacatcactgcaaacggaaaaccgctttgcccaagttctt
tccgctttaaaaaaggctgttcagaaaggggaaattccgcttcagcaaattaacaaatcg
gcggaacgcatcatttccctgaaaataaaaagaggtatatatcccgcaccgaaagaaaca
agtctgaaaaagaaagtcgcaaaagcaaagcaaaccgtcggaagcaaaaaccatctgaaa
gctgaaaaacaaatcgcggaaagatccgtcaccgtcttacaaaacaaaaaccgtacgctt
ccattcaaaccgaaaaagaacagccgcgttctcattgccgctccttatgaagatcaaaca
gcatccatggaacaaaccatccggcagctcatcaagaagaaaaagatccggccggtaacc
atcagtaaaatgaacttcgccgagcgcacatttaatgatgaggataaaaagctcgtatcc
gacgccgattacgtcattacaggctcatatgtcgtgaaaaatgaccctgtcgtaaacgac
ggcaacattgacgattctgtcacagatcccggcaagtggacgacggcatttccgcgggcc
gtcatgaaatctgcacaatcgaaccataaaccctttgtgctgatgagccttcgtaatcct
tacgacgccgctaattttgaagaagctgaagcccttatcgcagtctacggctttaaagga
tatgcagatggacaatttcttcagccaaacattccggcaggcattgaagcaatattcgga
cagacaaaaccgaaaggcaggctgcccgttgacattccttccgtcactcacccaggaacg
acactgtacccttatggcttcggaattaatctaaaaaccggaaaaccgctttaa

DBGET integrated database retrieval system