KEGG   Bacillus amyloliquefaciens XH7: BAXH7_00786Help
Entry
BAXH7_00786       CDS       T01836                                 

Gene name
acoC
Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
bxh00010  Glycolysis / Gluconeogenesis
bxh00020  Citrate cycle (TCA cycle)
bxh00620  Pyruvate metabolism
bxh01100  Metabolic pathways
bxh01110  Biosynthesis of secondary metabolites
bxh01120  Microbial metabolism in diverse environments
bxh01130  Biosynthesis of antibiotics
bxh01200  Carbon metabolism
Module
bxh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bxh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAXH7_00786 (acoC)
   00020 Citrate cycle (TCA cycle)
    BAXH7_00786 (acoC)
   00620 Pyruvate metabolism
    BAXH7_00786 (acoC)
Enzymes [BR:bxh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BAXH7_00786 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N HlyD_3 HlyD_D23 PYNP_C GCV_H EF_TS
Motif
Other DBs
NCBI-ProteinID: AEK87931
Position
774998..776191
Genome map
AA seq 397 aa AA seqDB search
MAVKVVMPKLGMAMKQGEVSVWNKKVGDPVEKGESIASINSEKIEMEVEAPESGTLLHIK
VKEGEGVPPGTAICYIGENGEKVQEKEAPAPENAGEPQAEPETIPAPKAGKERKHRVKIS
PVARKMAEKAGLKVDTLNGTGPGGRIVKADVIKAMKTEAEPRSSVQTAQPEGKPASAMRK
VIADRMHKSLQNSAQLTLTMKADITELVKWQKQLADSAKKRSGVKLTVTHFVSRAAVLAL
KQHPELNSSYQEERIITYPHVHLGMAVSLENGLVVPVIRDAEKLSFLELADQISTSARRA
REGNASGDDLHGSTFSITNLGGYGIEHFTPILNPPEAGILGVGASYETPAFKGDELVKST
VLPLSLTFDHRVCDGAPAADFLKTVKALLEEPAGLIL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaaaagtagtaatgccgaaattgggaatggcgatgaagcaaggtgaagtatca
gtctggaataagaaagtcggcgatccggttgaaaagggagaaagcatcgccagcatcaac
tctgaaaaaatagaaatggaagtagaagcgcccgaaagcggcacgctccttcacattaaa
gtcaaagagggagaaggagttccgccgggaacggccatctgttatatcggggaaaacggt
gaaaaggtgcaggagaaggaggcaccggcccctgaaaatgccggggaaccacaagcagaa
cctgaaactattcccgctcccaaagccgggaaagagcgtaaacaccgcgtgaaaatatcc
cctgtggcccgaaaaatggcggagaaggcaggattgaaagttgatacgctgaacgggacg
gggcccgggggcagaatcgtaaaagccgacgtcataaaggcgatgaagacggaagctgaa
ccgcggtcttcggttcagacggcacagccggagggaaaaccggcctcagcaatgagaaaa
gtgattgcagaccgaatgcacaaaagcctgcaaaacagcgcccagctgacactgaccatg
aaagcggacattacggagcttgtgaaatggcagaaacagctggccgacagtgcgaaaaag
cggagcggtgttaaactgacggtcacgcattttgtatcccgggccgcggtgcttgcgctg
aaacagcatcctgagctgaacagctcttatcaagaggagcggatcattacctatccgcat
gtccatctcgggatggcagtttctcttgaaaacggccttgtcgtgccggtgatccgtgat
gcggaaaagctttcattccttgagcttgcggatcaaatcagcacatctgcacgccgggcg
cgggaaggaaatgcttccggagatgatcttcacgggtcgactttttctattacaaatctc
gggggatatggaattgaacatttcaccccgatccttaatccgcctgaagccggtattctc
ggagtgggcgcaagctatgaaacgccggcgttcaaaggagatgagcttgtcaaaagcacc
gtgctgccgctgagcctcacctttgatcacagagtatgtgacggtgctccggctgcggac
ttcctgaaaacggttaaagcgctgcttgaagagccggccggattgattttatag

DBGET integrated database retrieval system