KEGG   Bacillus amyloliquefaciens XH7: BAXH7_00837Help
Entry
BAXH7_00837       CDS       T01836                                 

Gene name
ygaF
Definition
bacterioferritin comigratory protein; putative peroxiredoxin
Orthology
K03564  
peroxiredoxin Q/BCP [EC:1.11.1.15]
Organism
bxh  Bacillus amyloliquefaciens XH7
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
823727..824200
Genome map
AA seq 157 aa AA seqDB search
MTIEIGQAAPDMELLNDSGEEVSLTDFKGKYVVLYFYPKDMTPGCTTEACDFRDQHESFA
GLDAVIIGVSPDSRDKHEKFKQKHDLPFQLLVDDEHKLAEAFDVWKLKKNFGKEYMGIER
STFLLDKEGRLVKEWRKVKVKDHVAEALRELEQIAAN
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgacgattgaaatcggacaagcggcaccggatatggaattattgaacgacagcggagaa
gaagtatcattaacggattttaaagggaagtacgtcgtgctctatttttatccgaaagac
atgacacccggatgcacgacggaagcatgcgatttccgtgatcagcacgaaagttttgcg
ggacttgatgcggtcattatcggagtaagccctgacagccgtgacaaacatgaaaaattt
aaacagaaacacgatcttcctttccagctcctcgtcgatgacgagcataaactggcggaa
gcttttgacgtgtggaagctgaagaagaattttgggaaagaatatatgggaatcgagcga
tccacctttctgttagacaaagaaggccgtcttgtgaaggagtggagaaaagtaaaagtg
aaagatcatgttgcggaggctcttcgcgaattggaacaaattgcggcaaattaa

DBGET integrated database retrieval system