KEGG   Bacillus amyloliquefaciens XH7: BAXH7_01013Help
Entry
BAXH7_01013       CDS       T01836                                 

Gene name
apr
Definition
(GenBank) Subtilisin BPN' (EC:3.4.21.62)
  KO
K01342  
subtilisin [EC:3.4.21.62]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
Quorum sensing
Brite
KEGG Orthology (KO) [BR:bxh00001]
 Cellular Processes
  Cellular community
   02024 Quorum sensing
    BAXH7_01013 (apr)
Enzymes [BR:bxh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.62  subtilisin
     BAXH7_01013 (apr)
Peptidases [BR:bxh01002]
 Serine Peptidases
  Family S8: subtilisin family
   BAXH7_01013 (apr)
Chaperones and folding catalysts [BR:bxh03110]
 Intramolecular chaperones
  Subtilisin family
   BAXH7_01013 (apr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Structure
PDB: 

Jmol
Position
complement(986682..987830)
Genome map
AA seq 382 aa AA seqDB search
MRGKKVWISLLFALALIFTMAFGSTSSAQAAGKSNGEKKYIVGFKQTMSTMSAAKKKDVI
SEKGGKVQKQFKYVDAASATLNEKAVKELKKDPSVAYVEEDHVAHAYAQSVPYGVSQIKA
PALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETNPFQDNNSHGTHVAGTVA
ALNNSIGVLGVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSA
ALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVG
PELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENT
TTKLGDSFYYGKGLINVQAAAQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgagaggcaaaaaagtatggatcagtttgctgtttgctttagcgttaatctttacgatg
gcgttcggcagcacatcctctgcccaggcggcagggaaatcaaacggggaaaagaaatat
attgtcgggtttaaacagacaatgagcacgatgagcgccgctaagaagaaagatgtcatt
tctgaaaaaggcgggaaagtgcaaaagcaattcaaatatgtagacgcagcttcagctaca
ttaaacgaaaaagctgtaaaagaattgaaaaaagacccgagcgtcgcttacgttgaagaa
gatcacgtagcacatgcgtacgcgcagtccgtgccttacggcgtatcacaaattaaagcc
cctgctctgcactctcaaggctacactggatcaaatgttaaagtagcggttatcgacagc
ggtatcgattcttctcatcctgatttaaaggtagcaggcggagccagcatggttccttct
gaaacaaatcctttccaagacaacaactctcacggaactcacgttgccggcacagttgcg
gctcttaataactcaatcggtgtattaggcgttgcgccaagcgcatcactttacgctgta
aaagttctcggtgctgacggttccggccaatacagctggatcattaacggaatcgagtgg
gcgatcgcaaacaatatggacgttattaacatgagcctcggcggaccttctggttctgct
gctttaaaagcggcagttgataaagccgttgcatccggcgtcgtagtcgttgcggcagcc
ggtaacgaaggcacttccggcagctcaagcacagtgggctaccctggtaaatacccttct
gtcattgcagtaggcgctgttgacagcagcaaccaaagagcatctttctcaagcgtagga
cctgagcttgatgtcatggcacctggcgtatctatccaaagcacgcttcctggaaacaaa
tacggggcgtacaacggtacgtcaatggcatctccgcacgttgccggagcggctgctttg
attctttctaagcacccgaactggacaaacactcaagtccgcagcagtttagaaaacacc
actacaaaacttggtgattctttctactatggaaaagggctgatcaacgtacaggcggca
gctcagtaa

DBGET integrated database retrieval system