KEGG   Bacillus amyloliquefaciens XH7: BAXH7_01165Help
Entry
BAXH7_01165       CDS       T01836                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bxh00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1116862..1117434
Genome map
AA seq 190 aa AA seqDB search
MKEVNKEQIEQAVRQILEAIGEDPDREGLLDTPKRVAKMYAEVFSGLNEDPKEHFKTVFG
EDHEELVLVKDIAFHSMCEHHLVPFYGKAHIAYIPRGGKVTGLSKLARAVEAVSKRPQLQ
ERITSTIAESIVETLDPHGVMVVVEAEHMCMTMRGVRKPGAKTVTSAVRGIFKDDAAARS
EVLEHIKRAD
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagttaataaagaacagattgaacaggcagttcgccagattttagaggcgatt
ggagaagacccggaccgggaagggcttttagatacgccgaaacgtgtagcaaaaatgtac
gctgaagtattctcgggattaaacgaagacccgaaagagcattttaaaaccgttttcggc
gaggatcatgaggagcttgttcttgtaaaagatatcgcgtttcattctatgtgtgaacat
catcttgttcctttttacggaaaagcgcatattgcctacattccgcgcggcggtaaagtg
acgggcctgagtaaactggcgcgtgcggtagaagccgtctcaaaacgcccgcagctgcag
gagcgcattacgtcaacgattgcagaaagcatcgtagaaaccttagatccccacggcgtc
atggttgtcgtcgaagctgagcatatgtgcatgacgatgagaggcgttagaaagccgggg
gcaaaaacagtaacttccgctgtaagaggtatttttaaagatgacgcagcggcgcgttct
gaagtgttagaacatattaaacgtgcggattaa

DBGET integrated database retrieval system