KEGG   Bacillus amyloliquefaciens XH7: BAXH7_01177Help
Entry
BAXH7_01177       CDS       T01836                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
bxh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bxh01100  Metabolic pathways
bxh01110  Biosynthesis of secondary metabolites
bxh01130  Biosynthesis of antibiotics
bxh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bxh00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BAXH7_01177 (trpC)
Enzymes [BR:bxh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BAXH7_01177 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth
Motif
Other DBs
NCBI-ProteinID: AEK88319
Position
1127283..1128035
Genome map
AA seq 250 aa AA seqDB search
MLDQIIQQKKEEIKSIVLPENRQIERRSFKEAILNPNRFIGLIAEVKKASPSKGLIKEHF
VPEKIAADYEAAKADAISVLTDTRFFQGRNQFLTDVKQTVSLPVLRKDFIIDSLQVEESY
RIGADAILLIGEALEPSKLHELYLEAREKDMDVLVEVHDETVLERILQVFQPEILGINNR
DLKTFRTSVSQTEKMADLVPDGCLLVSESGIGSLADLKFVNKHGARAVLIGESLMREDSQ
QKAIRGLFGE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatcaaatcattcagcagaaaaaagaagaaatcaaatccatcgtgctgccggaa
aaccgtcaaattgaacggagatcctttaaagaagcgatcctgaacccgaaccgttttatc
ggactgattgccgaagtaaaaaaagcttcgccgtctaaaggactgattaaagagcatttt
gttcccgaaaagattgcggcggattatgaagctgccaaagcggatgccatctctgttctg
acggatacccgtttttttcagggaagaaatcaatttttgacagatgtgaaacaaaccgtt
tctcttcccgtgctgagaaaggattttattattgattccctgcaggtggaggaatcgtac
cggatcggcgccgatgcgattttgctgatcggggaagcgttggaaccctcaaagcttcat
gagctttatctggaggcccgtgagaaggatatggacgttctcgtggaagtccatgatgaa
accgtccttgaacggattttacaggtgtttcagccggaaattctcggcataaacaaccgg
gatttaaaaacgttccgtacttctgtttcacaaacggaaaaaatggcggatcttgtgccg
gacggctgtctgctggtcagcgaaagcggcatcggttctttggctgacctgaaattcgtc
aataagcacggggcgcgggctgtattgatcggagaatctttaatgagagaggattcgcag
caaaaggcgatccgcgggctgttcggggagtga

DBGET integrated database retrieval system