KEGG   Bacillus amyloliquefaciens XH7: BAXH7_01177Help
Entry
BAXH7_01177       CDS       T01836                                 

Gene name
trpC
Definition
Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bxh01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:bxh00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1127283..1128035
Genome map
AA seq 250 aa AA seqDB search
MLDQIIQQKKEEIKSIVLPENRQIERRSFKEAILNPNRFIGLIAEVKKASPSKGLIKEHF
VPEKIAADYEAAKADAISVLTDTRFFQGRNQFLTDVKQTVSLPVLRKDFIIDSLQVEESY
RIGADAILLIGEALEPSKLHELYLEAREKDMDVLVEVHDETVLERILQVFQPEILGINNR
DLKTFRTSVSQTEKMADLVPDGCLLVSESGIGSLADLKFVNKHGARAVLIGESLMREDSQ
QKAIRGLFGE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatcaaatcattcagcagaaaaaagaagaaatcaaatccatcgtgctgccggaa
aaccgtcaaattgaacggagatcctttaaagaagcgatcctgaacccgaaccgttttatc
ggactgattgccgaagtaaaaaaagcttcgccgtctaaaggactgattaaagagcatttt
gttcccgaaaagattgcggcggattatgaagctgccaaagcggatgccatctctgttctg
acggatacccgtttttttcagggaagaaatcaatttttgacagatgtgaaacaaaccgtt
tctcttcccgtgctgagaaaggattttattattgattccctgcaggtggaggaatcgtac
cggatcggcgccgatgcgattttgctgatcggggaagcgttggaaccctcaaagcttcat
gagctttatctggaggcccgtgagaaggatatggacgttctcgtggaagtccatgatgaa
accgtccttgaacggattttacaggtgtttcagccggaaattctcggcataaacaaccgg
gatttaaaaacgttccgtacttctgtttcacaaacggaaaaaatggcggatcttgtgccg
gacggctgtctgctggtcagcgaaagcggcatcggttctttggctgacctgaaattcgtc
aataagcacggggcgcgggctgtattgatcggagaatctttaatgagagaggattcgcag
caaaaggcgatccgcgggctgttcggggagtga

DBGET integrated database retrieval system