KEGG   Bacillus amyloliquefaciens XH7: BAXH7_01179Help
Entry
BAXH7_01179       CDS       T01836                                 

Definition
(GenBank) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bxh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BAXH7_01179
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAXH7_01179
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BAXH7_01179
Enzymes [BR:bxh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BAXH7_01179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1128674..1129876
Genome map
AA seq 400 aa AA seqDB search
MYPYPNEIGRYGEFGGKFVPETLMRPLEEIETAFKELKNDPVFHAEYKKLLFDYSGRPTA
LTFADRVSDDLGGAKIYLKREDLNHTGSHKINNALGQILLAKKMGKTKIIAETGAGQHGV
AAATAAAKFGFECTVFMGEEDVARQSLNVFRMKLLGAEVVPVSSGNGTLKDATNEAIRYW
VQHCEDHFYLIGSVVGPHPYPYIVREFQKIIGEEAKEQLLRVEGTLPDKVVACVGGGSNA
MGIFQAFLDEDTELIGVEAAGKGIDTPLHAATIAKGTLGVIHGSMTYLIQDAYGQIIEPY
SISAGLDYPGIGPEHAYLHKSGRVTYESVTDEEAIAALRLLSETEGILPAIESAHALAKA
FEMAKDMDKDKIILVSLSGRGDKDVHTLMNVLENGVKTHV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtatccatatccaaatgaaatcggaagatacggcgaattcggaggcaaatttgtccct
gaaacattgatgcggcctctcgaagaaatcgaaacggctttcaaagaattaaagaatgat
cccgtatttcatgcagaatataaaaaactattgtttgattactccggaagaccgactgca
ttgacgtttgcagacagggtgtcggatgatttgggcggggcgaaaatctatttgaaaagg
gaagatttaaaccataccggttctcataaaatcaacaacgcgttaggacagattctgctt
gccaaaaagatgggcaaaacgaaaatcatcgccgaaaccggtgcggggcagcacggcgtt
gcagccgcgacagccgccgcaaaattcggttttgagtgtacggtttttatgggtgaagag
gacgttgcgcgccagtcgctgaacgtattccgaatgaaactgctcggcgcggaggtcgtg
ccggtctctagcggcaacggcacactgaaagatgcgacgaatgaagcgatcagatattgg
gttcagcattgtgaagaccatttttacctgatcggttctgtcgtaggtccgcacccgtat
ccgtacattgtgcgcgagtttcagaaaatcatcggcgaggaagcgaaagaacagctcctc
agggtcgaagggacgctcccggacaaggttgttgcatgtgtcggcggcggaagcaatgcg
atgggcatatttcaggcctttttagacgaagatactgagctgatcggcgtcgaggcggcc
ggaaaaggaattgatacgcctctgcatgcggcgacgatagcaaaagggacgctcggggtg
attcacggctcaatgacctatttaatacaagatgcatacggacagattatcgaaccgtat
tccatttcagcaggcctcgattacccggggatcgggcctgagcatgcctatctgcataaa
agcggccgtgtaacatatgaaagtgtgacagacgaagaagcgattgccgcgttgcgtctg
ctttctgaaacagaaggcattcttccggctattgaatctgcacacgccttggcaaaagca
tttgaaatggcgaaagacatggataaagacaaaatcattctcgtcagtctgtcgggaaga
ggagataaagatgttcatacgctgatgaatgttttggaaaacggggtgaagacacatgtt
taa

DBGET integrated database retrieval system