KEGG   Bacillus amyloliquefaciens XH7: BAXH7_01180Help
Entry
BAXH7_01180       CDS       T01836                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase (alpha subunit) (EC:4.2.1.10)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bxh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BAXH7_01180 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAXH7_01180 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BAXH7_01180 (trpA)
Enzymes [BR:bxh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BAXH7_01180 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1129869..1130666
Genome map
AA seq 265 aa AA seqDB search
MFNLHDSEKLFIPFITAGDPLPEISVELAKSLQNAGASALEIGVPYTDPLADGPVIQRAS
KRALENGMNIVKAIELGGKMKKNGVHIPIILFTYYNPVLQLEKECFFALLRENDIDGLLV
PDLPLEESALLQKTCKKENIAYISLVAPTSENRLKIITEQAGGFVYCVSSLGVTGVRSEF
DPSVYSFIRKVKEFSSVPVAVGFGISSRKQVDEMNEISDGVVVGSALVRKVEELKTKLVN
SGTRADALLEFEEYAKTFGQLYSVK
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatctgcatgactctgaaaaattatttatcccttttattacggcgggcgatccg
cttcctgaaatttctgttgaactggcaaaatctttgcagaatgcaggcgcttcagctctt
gaaatcggcgtcccctacacagatccgctcgcggatggccccgtcatacagcgggcttca
aaacgggctctggaaaacggaatgaatatcgtaaaagccattgaacttggcggcaaaatg
aaaaaaaacggcgttcatattccaattatcctctttacgtattataatcctgtgttacaa
ttagaaaaagaatgctttttcgctttactgcgggaaaacgacatagacggtctgcttgta
ccggatcttccgttagaggaaagcgcccttttgcaaaagacatgcaaaaaggagaacatc
gcttatatctcgctggtcgcgccgacaagtgaaaaccgtttgaaaataattactgaacag
gccggcggctttgtgtattgtgtatcttctttaggagtgacgggcgtacgcagcgaattc
gatccgtctgtatactctttcatccgtaaagtgaaagaattcagctcggttccggttgcg
gtcggttttggcatttcaagccgcaaacaggttgacgagatgaatgaaatatcagatggt
gtcgttgtcggaagcgcgcttgtcagaaaggttgaagagcttaaaacaaagcttgtgaat
tccggcacaagagccgatgcgcttcttgaatttgaggaatacgcaaagacgttcggacaa
ctgtacagtgtaaaatga

DBGET integrated database retrieval system