KEGG   Bacillus amyloliquefaciens XH7: BAXH7_01494Help
Entry
BAXH7_01494       CDS       T01836                                 

Definition
hypothetical protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bxh00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:bxh00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1376051..1377529
Genome map
AA seq 492 aa AA seqDB search
MFFKKGLYMTLAFLLLSFLLSGSMETEVYATDRKAPDKNKVRVWYSSEKDPASRTWYDGP
KEVKYALDEQTPLTLTKKKASDSTAVYIDPSHRYQSVLGIGSSLEESTISNLSKMSPGKR
KEVLKKLVDPNEGIGMDVMRITIGTSDFTAQEFYTYDDMPEGRKDPKLRHFSIQKDIDLH
ITATIKEALAINPKLKIIASPWSPPAWMKTNENLKRGKLKDKYISELAVYFRKFIEAYEK
QGIPIYAMTLQNEPLLEIDYPSMYMPPSQQRKLAQALKKEMKKHLIDTKIWIYDHNASGA
WNYIPPILDDKKGNQAADGIAFHDYDGDLSVMSEIGRRYPDKSIHLTERSVWGTEGADRI
AQYFRNGASSYNAWVTMLDSQIKTHHWIGTPDPTLFIQDAKNPDRYWNIPIYHMTGNFSK
FVDRGAKRIESNYGSKNTVSNVSFLNPDQSIVTVVINQTSAEQKFHVVSEDRQFEAVIPA
KTVATYKWQHKK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgttttttaaaaaaggtctgtacatgacgctggcttttcttttgctttcttttttatta
tcaggcagcatggaaaccgaagtgtatgcgactgatcggaaagctccggacaaaaacaaa
gtaagggtgtggtacagttcggaaaaagatccggcttcccgtacatggtatgacggtccg
aaagaagtgaaatacgccttagatgaacaaaccccactgactttgacaaaaaagaaggct
tctgactccactgccgtgtatattgatccgtcgcaccgctatcaaagtgtattaggcata
ggatcatctctggaagaatccactatctctaatttatcgaaaatgtcgcccggaaaaaga
aaagaagtgttgaaaaaactggttgatcccaatgaaggcatcggcatggacgtcatgcgc
ataacgatagggacatcagattttacggcccaggaattttatacgtatgacgatatgcct
gaaggccgaaaagatcctaagctcagacatttctcgattcaaaaggatattgatttacac
attacagcaaccatcaaggaagcgctggcgataaatccgaagctgaaaatcattgcctca
ccgtggagcccgcccgcatggatgaaaacgaatgaaaatctcaagcgaggaaagctgaaa
gataaatatatcagcgagctggccgtttatttccgcaaatttattgaagcgtacgaaaag
caagggatcccgatttatgcgatgactcttcaaaatgaacctttgctggaaattgactat
ccgagcatgtatatgccgccgtctcagcagcgcaaactggcgcaggccttaaaaaaagaa
atgaagaaacatttaattgacacgaaaatttggatttatgatcacaatgcaagcggggcg
tggaactatattccgccgattttagatgataaaaaaggaaaccaggcggcagacggcatt
gcttttcatgattatgacggagacctttccgtcatgtcggaaatcggaaggcgatatcct
gataaatctattcacttaacggagcggtctgtctgggggacagaaggagcggaccggatc
gcgcagtatttccgcaacggcgcgtccagctacaatgcgtgggtgacgatgctcgacagt
caaattaagacgcatcattggataggcaccccggatccgacgctgtttattcaggacgct
aaaaatcctgaccgctattggaatatcccgatctatcatatgacaggcaacttttcaaaa
tttgtcgaccgcggagcaaaacggatagaaagtaattacggctccaaaaacacagtttcg
aacgtatcgtttcttaatcctgatcaatccattgtaacagtcgtgatcaaccagacatct
gcggagcaaaaattccatgtcgtttcagaggatcggcagttcgaagccgttatcccggct
aaaaccgtcgctacctacaaatggcagcacaaaaagtaa

DBGET integrated database retrieval system