KEGG   Bacillus amyloliquefaciens XH7: BAXH7_01570Help
Entry
BAXH7_01570       CDS       T01836                                 

Gene name
proJ
Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
bxh00330  Arginine and proline metabolism
bxh00332  Carbapenem biosynthesis
bxh01100  Metabolic pathways
bxh01130  Biosynthesis of antibiotics
bxh01230  Biosynthesis of amino acids
Module
bxh_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bxh00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BAXH7_01570 (proJ)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BAXH7_01570 (proJ)
Enzymes [BR:bxh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BAXH7_01570 (proJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AEK88708
Position
1436742..1437860
Genome map
AA seq 372 aa AA seqDB search
MTSRTEIKRVAVKIGSSSLTSLHGEISRRKLETLVDQIAQLKDRGYEVILVSSGAVAAGY
RKLGFIQKPESLPEKQASASIGQGLLMEAYSKLFLAHGYVASQILITRSDFSDEYRYHNV
RNTMNVLLERGIIPIINENDTVTVNRLKFGDNDTLAAKVAGLIDADMLVILSDIDGLYND
NPRSNPKAQRIRHVSDITPEIEASAGDAGSEMGTGGMRSKLDAFKIVMASGIKGFLGQAN
APDILLEAVEEAAEGTYFEAEGTLPLSHKEQWLAFNSGPEGEIVMEKESSRDVANGNVAL
SPQDIEQIKGKFSSGAVVRLLDQQGEELGLGIVNYSSAQLMTFKETPHKQTEQSVIDPEA
FVCHVELSIPIG
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtctcggacagagatcaaaagagtcgcggtgaaaatcggcagcagctcactgacg
agcctgcacggagaaatcagcagaagaaaactggaaactttggtggatcaaatcgcacag
ctgaaagacagaggctatgaagtgattttagtatcttccggggcggtggcggcaggttat
cgaaaactcggatttattcagaaaccggaaagcctccctgagaaacaggcttctgcttcc
atcgggcagggattattaatggaggcctattcaaagctgtttttagcgcacggttatgtc
gcgtcacaaattttaattacaagaagcgacttttccgatgaataccgctaccacaatgtc
cgcaatacgatgaacgtccttttggaacgaggcattattccgattattaatgaaaatgac
accgtcacagtcaaccggctgaaattcggtgataacgatacactcgcagcaaaggtggca
ggtttaattgatgccgacatgcttgtgattttatcagacattgacggattatataatgat
aatccgcgcagcaacccgaaagcgcaaagaatccggcatgtaagtgacatcaccccggaa
atagaagcaagcgcgggagatgccggaagtgagatgggaaccggcggaatgcgctcaaaa
ctggatgcttttaaaattgtgatggcctccggtattaaaggctttctcgggcaggctaac
gctccggacatactgctggaggcggtagaagaggcggctgaaggaacttattttgaagcg
gaaggaaccctgccgttaagccacaaagaacaatggcttgcatttaattccggccccgag
ggcgaaattgtaatggaaaaggaaagcagccgcgatgtagcgaacggaaatgtggcgctg
tcaccgcaggacattgaacagattaagggcaaattcagcagcggggcggttgtcagactg
cttgatcagcagggagaagagctcgggctcggcatcgtcaattattcctcggcccagctg
atgacatttaaagaaacgccgcacaaacagaccgagcaatcggttattgatccagaagcg
tttgtctgccacgttgaactgtccatcccgatcggctga

DBGET integrated database retrieval system