KEGG   Bacillus amyloliquefaciens XH7: BAXH7_01614Help
Entry
BAXH7_01614       CDS       T01836                                 

Gene name
yxjF
Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
bxh00072  Synthesis and degradation of ketone bodies
bxh00650  Butanoate metabolism
bxh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bxh00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BAXH7_01614 (yxjF)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BAXH7_01614 (yxjF)
Enzymes [BR:bxh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BAXH7_01614 (yxjF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Polysacc_synt_2 3Beta_HSD 3HCDH_N Methyltransf_25 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AEK88752
Position
1492163..1492948
Genome map
AA seq 261 aa AA seqDB search
MDPLLKDKAAVVTGAARGIGFEIAQEFTREGAAVIIADVNEQAGKEAAAKLSEEGAHAKS
ITCDVTDEKQTADMIQKAVTEFGRLDILVNNAGIQHIAPIEAFPAEQFERLIRVMLTAPF
IAMKHAFPVMKKQQFGRIINMASVNGLIGFYGKAAYNSAKHGVIGLTKVGALEGAADGIT
VNALCPGYVDTQLVHNQLKDISDTRNVPYERVLEDVIFPLVPQKRLLSVKEIADYAVFLA
SDKAKGVTGQAVVMDGGYTAQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggacccattgctgaaagacaaagcggctgtagtgacaggagcagccagaggaatcgga
tttgaaatcgctcaagaattcacccgtgaaggagccgccgtaatcatagcggatgtcaat
gaacaggcgggaaaagaagccgcagcaaaactcagtgaagaaggcgctcatgccaaaagc
atcacgtgtgatgtaaccgatgaaaagcaaacggctgatatgattcaaaaagccgtgaca
gaattcgggcgactcgatattctcgtgaataacgcgggcattcagcatatcgcccccatt
gaggcatttcccgcggaacaatttgaacggctcatccgtgtcatgctgaccgcgccattt
atcgccatgaaacatgcatttcccgtcatgaaaaaacagcaattcggacgaatcataaat
atggcgtctgtcaacgggctcatcggtttttacggaaaagccgcatataacagcgccaag
catggcgtcatcggcttaacgaaagtcggcgcacttgaaggcgcggctgacggcatcacc
gtcaatgccctctgtcctgggtatgttgacacacagctcgtccacaatcagctgaaggac
atttctgacacaagaaatgtgccgtatgaacgtgttctggaggacgtcatctttccgctc
gttccccaaaaacggctgctctcagtgaaggaaatcgctgattacgccgtgtttttggcc
agcgacaaagcaaaaggcgtcaccggtcaggccgtcgtcatggacggaggatataccgct
caatag

DBGET integrated database retrieval system