KEGG   Bacillus amyloliquefaciens XH7: BAXH7_01700Help
Entry
BAXH7_01700       CDS       T01836                                 

Gene name
xylA
Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bxh00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bxh00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1594166..1595503)
Genome map
AA seq 445 aa AA seqDB search
MAHSHSGSVNYFESVNKVIYEGKDSTNPLAFKYYNPQEVIGGKTMKEHLRFSIAYWHTFT
ADGTDIFGAATMQRPWDHYKGMDLARARVEAAFEMFEKLDAPFFAFHDRDIAPEGSTLKE
TNQNLDIIVSMIKEYMRNSGVKLLWNTANMFTNPRFVHGAATSCNADVFAYAAAQVKKGL
ETAKELGAENYVFWGGREGYETLLNTDLKFELDNLARFMHMAVDYAKEIGYTGQFLIEPK
PKEPTAHQYDTDAATTIAFLKQYGLDNHFKLNLEANHATLAGHTFEHELRMARVHGLLGS
VDANQGDPLLGWDTDEFPTDLYSATLAMYEILQNGGLGSGGLNFDAKVRRSSFEPDDLLY
AHVAGMDAFARGLKVAHKLIEDRVFEDVIQHRYRSFSEGIGLEIAEGRANFKTLEQYALN
NKPIKNESGRQERLKAILNQYILEV
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggctcactctcattctggttcagtcaactattttgaaagcgtaaacaaagtgatttac
gaagggaaagattcgactaatcctttagcatttaaatattataatcctcaagaagtaatc
ggcggaaaaacgatgaaagaacatttgcgattttctattgcttattggcatacctttact
gctgacggcacagacatttttggagcagctacgatgcaaaggccgtgggatcactataaa
ggtatggatctcgcgagggcgagagtagaagcggcatttgaaatgtttgaaaaactggat
gcgcctttttttgcttttcatgaccgggatattgcaccggaaggcagtacgttaaaagag
acaaatcaaaatttagatattatcgtgagcatgataaaagagtacatgagaaacagcggc
gttaagctattatggaatactgcaaacatgtttacgaatccgcgtttcgtccatggcgcc
gcgacttcttgcaatgcagacgtatttgcatatgctgcagcacaagtaaaaaaagggtta
gaaacggcaaaagagcttggcgccgagaactatgtattttggggcggccgtgaaggatac
gaaacattgctaaacaccgatttgaaatttgagcttgataatttggccagattcatgcat
atggcagtggattacgcgaaggaaatcgggtataccgggcagtttttgattgaaccgaaa
ccaaaagagccgaccgctcatcaatatgatacagatgcagctacaaccattgcctttttg
aagcaatatggcctggacaatcattttaaattaaatcttgaagccaatcatgccacatta
gccggacatacattcgaacatgagttacgcatggccagagtgcatggtcttcttggctct
gttgacgcaaatcagggtgatcctcttttaggctgggacacggatgaatttccgacagat
ttatattctgcgacattggcaatgtacgaaattctgcaaaatggcggccttggaagcggc
ggattaaactttgacgcgaaggtcagaagatcttcttttgagcctgatgatctattatat
gcccatgttgcagggatggatgcatttgcaagaggattgaaagtcgcccacaaattaatc
gaagaccgtgtgtttgaagatgtgattcaacaccgttaccgcagcttttctgaagggatt
ggccttgaaattgcagaaggaagagctaatttcaagacacttgagcaatatgcgctgaat
aataaaccaattaaaaacgaatcaggaagacaggagcgattaaaagcgatattgaaccaa
tacattttagaagtataa

DBGET integrated database retrieval system