KEGG   Bacillus amyloliquefaciens XH7: BAXH7_01853Help
Entry
BAXH7_01853       CDS       T01836                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
bxh00020  Citrate cycle (TCA cycle)
bxh00640  Propanoate metabolism
bxh00660  C5-Branched dibasic acid metabolism
bxh01100  Metabolic pathways
bxh01110  Biosynthesis of secondary metabolites
bxh01120  Microbial metabolism in diverse environments
bxh01130  Biosynthesis of antibiotics
bxh01200  Carbon metabolism
Module
bxh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bxh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bxh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAXH7_01853 (sucC)
   00640 Propanoate metabolism
    BAXH7_01853 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BAXH7_01853 (sucC)
Enzymes [BR:bxh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BAXH7_01853 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AEK88985
Position
complement(1800927..1802084)
Genome map
AA seq 385 aa AA seqDB search
MNIHEYQGKEVLRKYGVSVPEGKVAFTAEEAVEKAESLSSSVYVVKAQIHAGGRGKAGGV
KIAKTTDEVKEYAEELLGKTLVTHQTGPDGQVIKRLLIEEGCDIKKEYYVGLVLDRATSR
IVLMASEEGGTEIEEVAEKTPEKIKKAVIDPAVGLQGYQAREIAFAINIPKELVGKAAKF
MLGLYKAFVEKDCSIAEINPLVVTGDGNVMALDAKLNFDSNALYRQKDIMEYRDLDEEDP
KEIEASKYDLSYISLDGNIGCMVNGAGLAMSTMDIIKHYGGEPANFLDVGGGATAEKVTE
AFKIILSDQNVKGIFVNIFGGIMKCDVIAEGVVEATRQVGLTLPLVVRLEGTNVDLGKKI
LNESGLNITSAESMADGAQKIVSLV
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtaccagggaaaagaagtcctcagaaaatacggggtgtctgttcct
gaaggtaaagtggcttttacagcagaggaagcagttgaaaaagcagagagcctgtcaagc
tcggtttatgtcgtaaaggcgcaaatccatgctggcggccgcggcaaagctggtggggta
aagattgcaaaaacaacggatgaagtgaaggagtatgccgaagaactgttaggcaagacg
ctcgtcacacatcaaacgggtccggacggacaagtaataaaacgcttacttattgaagaa
ggctgcgatattaaaaaggaatactacgtcgggcttgtacttgaccgcgccacttcaaga
atcgttttaatggcgtctgaagaaggcggaacggaaattgaagaagtagcggaaaaaaca
cctgaaaaaattaaaaaagcggttattgatccggctgtaggccttcagggctatcaagcg
agggagattgcattcgcaattaacatcccgaaagagcttgtcggcaaagccgctaaattt
atgctcggactatataaagcatttgttgagaaggactgctccatcgccgagatcaaccct
ctcgtcgtcacgggagacggaaacgtcatggcgcttgatgctaagctgaacttcgacagt
aatgcgttatacagacaaaaagacattatggaatacagagatttagatgaagaagatccg
aaagaaatcgaagcctcaaaatacgatttaagctacatttcccttgatggaaatatcggc
tgtatggtaaacggcgcgggtcttgcaatgtctacaatggatatcattaaacactacggc
ggagaacctgcaaacttcctggatgtcgggggcggcgcaaccgctgaaaaagttacggaa
gcttttaaaatcattctttccgatcaaaacgtaaaaggaattttcgttaatattttcggc
ggcatcatgaagtgtgatgtcattgccgaaggcgttgttgaagcgacgagacaagtcgga
ttgacattgccgctggtcgtgcgccttgaagggacaaacgtagatttaggaaagaaaatc
ctgaatgaatcaggcttaaatatcacatctgcggaatcaatggcagacggcgcgcagaaa
atcgtatccttagtttag

DBGET integrated database retrieval system