KEGG   Bacillus amyloliquefaciens XH7: BAXH7_02791Help
Entry
BAXH7_02791       CDS       T01836                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bxh03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2599958..2600563)
Genome map
AA seq 201 aa AA seqDB search
MIEFVKGTIDYVSPQYIVIENGGIGYQVFTPNPFIYKVSNQETIFTYHHIKEDAFSLYGF
STREEKALFTKLLNVTGIGPKGALAILGSGDPGAVIEAIEQEDEAFLVKFPGVGKKTARQ
IILDLKGKLADVVPEMIDNLFNHEARIEKQEAETALDEALEALRVLGYAEKEIKKVLPHL
KEETALSTDQYVKKALQKLLK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgattgaattcgtgaaggggacgattgattacgtatcgccccaatacatcgtgattgaa
aacggcgggatcggctatcaggtcttcactccgaatccgtttatttataaggtaagcaat
caagagaccatttttacgtatcatcatataaaagaagacgccttttctttgtatggcttt
tcaacccgggaagaaaaagcgcttttcacaaagctgctgaatgtcaccggcatcggtccg
aaaggggcgctcgccattctcggttccggtgatccgggagccgtcatcgaagcgatcgaa
caggaagatgaagcctttttggtgaaatttcctggtgtgggcaaaaaaacggcacggcag
attattcttgatttgaaaggcaaactggccgatgtcgtgcctgaaatgattgacaacctg
ttcaatcatgaagcgcgcattgaaaaacaagaggctgaaacggcgcttgatgaggcgctt
gaagcgctcagggtactcggctacgccgaaaaagaaattaaaaaagtgcttcctcactta
aaagaggaaacggcgctttcaacagaccaatatgtgaaaaaagcattgcaaaaattatta
aagtaa

DBGET integrated database retrieval system