KEGG   Bacillus amyloliquefaciens XH7: BAXH7_02869Help
Entry
BAXH7_02869       CDS       T01836                                 

Gene name
ysiB
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bxh00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BAXH7_02869 (ysiB)
  Lipid metabolism
   00071 Fatty acid degradation
    BAXH7_02869 (ysiB)
Enzymes [BR:bxh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BAXH7_02869 (ysiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2673241..2674020)
Genome map
AA seq 259 aa AA seqDB search
MNSLSVAVEQSVAVITIDHQPANALSGAILDELSGLFDRYETDDSVRSIIIRGEGKFFSA
GADIKEFTSLENLEQSSAMADKGQQLMEKIEGFPKPVIAAIHGAALGGGLELAMACHIRI
ATLDAKLGLPELNLGIIPGFAGTQRLPRYVGTAKALEMIGTSEPVTGEEALSLGLVTIGA
ANEEELLQKAKTLAGKFAEKSPQSMAFLLELLYTNKVYSYDGGLKLEAKRFGEAFASDDA
KEGIQAFLEKRKPQFGGRR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcctttcagtggcggtagaacaatctgtcgcggtgatcaccattgatcatcag
ccggccaacgcgctgtccggtgcgattttagacgagttgtccggtctgttcgaccggtat
gaaacagatgacagcgtcagaagcatcatcattcgcggtgaggggaaatttttctcggcg
ggcgccgatataaaggaatttacgtcgcttgaaaaccttgagcagtcttctgccatggcg
gataaaggccagcagctgatggaaaaaattgaagggtttccaaagcctgttatcgcggcg
attcacggcgctgcgctcggcggcggtctggagcttgccatggcctgtcatatcagaatc
gctacattggatgcaaagctcggcctgcccgagctgaatctcggcattattccgggcttt
gccgggacgcagcgtctgccccggtacgtcggcacggcgaaagcgcttgaaatgatcggc
acttcagaacctgtgaccggagaagaagcgctcagcctcgggcttgtcaccataggcgcc
gcaaatgaggaagagctgctgcaaaaggcgaaaacgctggcgggcaagtttgcggaaaaa
agcccgcagtcgatggcttttctgcttgagctcctttatacaaacaaggtttattcttat
gacggcggcttaaagcttgaagcaaagcgctttggggaagcatttgcatcagatgacgca
aaagaaggcattcaggcatttctcgaaaaaagaaagcctcaattcggtgggcgaagataa

DBGET integrated database retrieval system