KEGG   Bacillus amyloliquefaciens XH7: BAXH7_02935Help
Entry
BAXH7_02935       CDS       T01836                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
bxh00010  Glycolysis / Gluconeogenesis
bxh00030  Pentose phosphate pathway
bxh00051  Fructose and mannose metabolism
bxh00052  Galactose metabolism
bxh00680  Methane metabolism
bxh01100  Metabolic pathways
bxh01110  Biosynthesis of secondary metabolites
bxh01120  Microbial metabolism in diverse environments
bxh01130  Biosynthesis of antibiotics
bxh01200  Carbon metabolism
bxh01230  Biosynthesis of amino acids
bxh03018  RNA degradation
Module
bxh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bxh_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bxh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAXH7_02935 (pfkA)
   00030 Pentose phosphate pathway
    BAXH7_02935 (pfkA)
   00051 Fructose and mannose metabolism
    BAXH7_02935 (pfkA)
   00052 Galactose metabolism
    BAXH7_02935 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BAXH7_02935 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BAXH7_02935 (pfkA)
Enzymes [BR:bxh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BAXH7_02935 (pfkA)
Protein phosphatases and associated proteins [BR:bxh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BAXH7_02935 (pfkA)
Messenger RNA biogenesis [BR:bxh03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BAXH7_02935 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AEK90059
Position
complement(2742100..2743059)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHDVEVYGIYNGYSGLISGKIEKLELGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIENLKKLGIEGLVVIGGDGSYMGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLAGGAESILIPEADYDMEEIIGRLKRGHDRGKKHSIIIVAEGVGSGVEFGKRIEEETNL
ETRVSVLGHIQRGGSPSASDRVLASRLGAYAVELLLEGKGGRCVGIQNNKLVDHDIIEIL
ETKHTVEPNMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtataggagtattaacgagcggcggggattccccggggatgaacgcagcggtg
cgcgcggttgtgcggaaagctatctaccacgatgtagaagtatacggaatttataacggt
tattcaggattaatcagcggaaaaatagagaaactggagctgggttcggtcggcgacatc
atccatcgcggaggaacaaagctgtacacggccagatgtcctgaattcaaaacagttgaa
ggccgtgaaaaaggaatcgaaaatttaaagaaactcggcatcgaaggtcttgtcgttatc
ggcggagacggttcatacatgggtgcgaaaaaattaacggaacacgggtttccatgtgta
ggtgtaccgggtacgatagataatgacatcccgggaactgattttacgatcggatttgat
acggcgttaaacaccgtaattgatgcgattgataaaatccgtgacaccgctacgtcgcat
gagcgtacatacgttattgaagttatggggcgccatgcaggcgacattgctttatgggca
gggcttgcaggcggagcggaatcaattttaattcctgaagcggattacgatatggaggaa
attatcggccgtttgaagagagggcatgaccgcggcaaaaaacacagtatcatcatcgtt
gcagaaggggtaggcagcggggttgaattcggaaaacgcatcgaagaagagacgaacctt
gaaacacgggtatccgttttagggcacatccagcgcggcggatctccaagcgcttctgac
cgggttcttgcaagccgcctcggcgcttacgcggttgagcttctgcttgaaggaaaaggc
ggacgctgcgtaggtatacaaaacaacaagcttgtagaccatgatattatagaaatttta
gagacaaaacatactgttgaaccaaacatgtatcagctttcaaaagaactgtctatttaa

DBGET integrated database retrieval system