KEGG   Bacillus amyloliquefaciens XH7: BAXH7_02990Help
Entry
BAXH7_02990       CDS       T01836                                 

Gene name
acsA
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
bxh00010  Glycolysis / Gluconeogenesis
bxh00620  Pyruvate metabolism
bxh00640  Propanoate metabolism
bxh00680  Methane metabolism
bxh01100  Metabolic pathways
bxh01110  Biosynthesis of secondary metabolites
bxh01120  Microbial metabolism in diverse environments
bxh01130  Biosynthesis of antibiotics
bxh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bxh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAXH7_02990 (acsA)
   00620 Pyruvate metabolism
    BAXH7_02990 (acsA)
   00640 Propanoate metabolism
    BAXH7_02990 (acsA)
  Energy metabolism
   00680 Methane metabolism
    BAXH7_02990 (acsA)
Enzymes [BR:bxh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BAXH7_02990 (acsA)
Lipid biosynthesis proteins [BR:bxh01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BAXH7_02990 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEK90114
Position
complement(2789479..2791197)
Genome map
AA seq 572 aa AA seqDB search
MNLKALPAEKGNYHLQNYEETYRSFDWKEAEAEFSWHQTGKLNAAYEAIDRHAESFRRNK
VALYYKDANREEKYTFKEMMEESNRAGNVLRRYGNVEKGDRVFIFMPRSPELYFIMLGAI
KIGAIAGPLFEAFMEGAVKDRLLNSQAKVVVTTPELAERIPAESLPDLQHIFIVGGSEET
GDKIIHYDKAAEGESTRLDIEWMDRRDGYLLHYTSGSTGTPKGVLHVHEAMIQQYQTGKW
VLDLKEDDIYWCTADPGWVTGTVYGIFAPWLNGAANVIVGGRFSPENWYGTIEKLGVSVW
YSAPTAFRMLMGAGDEMASKFDLTSLRHVLSVGEPLNPEVIKWGHKVFGKRIHDTWWMTE
TGGQLICNYPCMEIKPGSMGKPIPGVEAAIVDNQGNELPPYRMGNLAIKKGWPSMMDSIW
NNKEKYDSYFMPGGWYVSGDSAYMDEDGYFWFQGRVDDVIMTSGERVGPFEVESKLVEHP
AIAEAGVIGKPDPVRGEIIKAFIALREGHEPSDQLKEDIRLFVKQGLAAHAAPREIEFKD
KLPKTRSGKIMRRVLKAWELNLPAGDLSTMED
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgaacttgaaagcgttgccagcagaaaaggggaattatcatctgcaaaattatgaggaa
acataccgcagcttcgattggaaagaagcagaggccgagttttcctggcatcagaccggg
aagctgaatgccgcatacgaagcgattgaccgccatgccgagtcatttcgcagaaacaaa
gtagcgctgtattacaaggacgcaaacagagaagaaaaatacacatttaaagaaatgatg
gaggaatcgaaccgggcgggaaatgtgctgagacggtatggaaacgtggaaaaaggagac
cgcgtttttattttcatgcctcgttcgccggagctgtattttatcatgctcggcgctatt
aaaatcggtgcgattgccggtcctttatttgaagcgtttatggaaggcgccgtcaaagac
cgtctgctgaacagccaggcaaaggttgtcgtgacaacacctgagctggccgaacggatt
ccggcagagagtctccccgacctgcagcatattttcattgtcggcggcagcgaagaaacg
ggagataaaatcatccattacgataaagcggctgaaggggaaagcacgagacttgacatt
gaatggatggacagaagagacggctacctgcttcattacacatcaggttctaccggaacg
cctaagggcgtgcttcacgttcatgaagccatgattcagcaataccagaccggcaagtgg
gtgcttgatctcaaagaagacgatatttactggtgcactgcggacccaggttgggtgacc
gggacggtgtacgggatttttgcgccgtggctgaacggagcggcgaacgtaatcgtcggc
ggcagattcagtccggaaaactggtacggcacaattgaaaagctcggtgtcagcgtctgg
tacagcgctccgaccgctttcagaatgcttatgggcgccggagatgaaatggcgtccaaa
tttgaccttacctcacttcgtcacgtcctgagtgtcggagagcctttaaaccctgaggtc
atcaagtgggggcataaagtattcggcaagcgcatccatgatacgtggtggatgacggaa
accggcggacagcttatctgcaattatccttgcatggagatcaagccgggttcaatgggg
aaaccgattccgggagtggaagcggcgatcgttgacaatcaaggaaatgaacttccgccg
taccggatggggaacctcgccattaaaaagggctggccgtccatgatggattccatttgg
aataacaaagaaaaatatgattcttatttcatgccgggcggctggtatgtttccggagat
tcagcttatatggatgaagacggttatttctggttccaaggcagagtcgatgatgttatt
atgacatccggcgagcgtgtcggcccgtttgaagtcgaaagcaaacttgttgaacatccg
gcgattgccgaagccggtgtcatcggaaagccggatcctgtccggggagaaatcattaaa
gcgtttatcgccctcagagaaggacatgaaccatccgatcagctgaaggaggacattcgc
ctctttgtaaaacaagggcttgccgcgcatgccgcaccgcgtgaaattgagttcaaagat
aaactgccgaaaacacgaagcggaaaaatcatgcgacgtgtcctgaaggcgtgggagctg
aacctgccggcaggcgacctgtccacaatggaagattaa

DBGET integrated database retrieval system