KEGG   Bacillus amyloliquefaciens XH7: BAXH7_03063Help
Entry
BAXH7_03063       CDS       T01836                                 

Gene name
ytpA
Definition
bacilysocin synthesis or export phospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bxh00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BAXH7_03063 (ytpA)
Enzymes [BR:bxh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BAXH7_03063 (ytpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2855214..2855993)
Genome map
AA seq 259 aa AA seqDB search
MWTWKADRPVGTIVIIHGASEYHGRYKWLVEMWRSSGYNVVMGDLPGQGTSTRARGHIRS
FQEYIDEVDIWIDQARTLESPVFLLGHSMGGLIAIEWFKQQRNPRITALILSSPCLGLQI
KVNKVLDFASKGLNVLAPSLRVDSGLSPDMATRNADMIEADQNDSLYVTKVSVRWYRELL
KTIDAAMVPTDAFLKVPLLLMQGGDDKIVDKMKVRKWFSGVASHNKSYREWEGLYHEIFN
EPEREAVFKAAKAFTDQYI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtggacttggaaagcagacaggcccgtcggtaccattgtcataatccacggggcaagc
gaataccacgggcgttataaatggctcgttgaaatgtggagatcttccggatataacgtg
gtgatgggtgatttgcccggtcagggaacatccacccgcgccagagggcatattcgctct
ttccaagaatacattgatgaagtagatatatggattgatcaagcgagaacgcttgaatcg
cccgttttccttttgggccacagcatgggcggactgattgcgatagaatggtttaagcag
cagagaaatccccgcattacggcactcattttatcatcaccttgtcttgggctgcaaata
aaagtcaataaagtgcttgattttgcgtctaaaggactgaatgttctcgccccgtccctc
agagtggactccggtttatcgcctgatatggcgacaaggaatgcggatatgattgaagcg
gatcaaaacgattctttatatgtcacgaaagtatctgtaagatggtacagagagctttta
aaaaccattgatgccgctatggtgccgactgatgcgtttttaaaagtgccgcttttgctt
atgcagggcggtgatgacaaaatcgttgataaaatgaaggtccgtaaatggttttccggt
gtggcttcccataataaatcataccgggaatgggaagggctttatcatgaaatttttaat
gaaccggaaagagaagctgtgtttaaggcggcgaaagcctttacagatcagtatatttga

DBGET integrated database retrieval system