KEGG   Bacillus amyloliquefaciens XH7: BAXH7_03330Help
Entry
BAXH7_03330       CDS       T01836                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bxh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BAXH7_03330 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAXH7_03330 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BAXH7_03330 (thrC)
Enzymes [BR:bxh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BAXH7_03330 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3097774..3098832)
Genome map
AA seq 352 aa AA seqDB search
MWKGLIHQYKEFLPVTDQTPALTLHEGNTPLIHLPKLSEKLGVELHVKTEGVNPTGSFKD
RGMVMAVAKAKEEGNDTIMCASTGNTSAAAAAYAARAGMKCIVIIPDGKIAFGKLAQAVM
YGAEIIAIDGNFDDALAIVRSICEKAPIALVNSVNPYRIEGQKTAAFEVCEQLGGAPDIL
AIPVGNAGNITAYWKGFKEYHEKNGTGLPKMRGFEAEGSAAIVRGEVIKNPETVATAIRI
GNPASWDKAVLAAKESAGKIDEVTDEEILHAYQLIAREEGVFAEPGSCASIAGVLKQVKS
GEIPKGSKVVAVLTGNGLKDPNTAVDVSELKPVTLPTNEDNILEYLNGAARV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaaggactcattcatcaatataaagaatttctgccggtaacggatcagacgccg
gctctgacattgcatgaaggcaacacgccgctcattcaccttccgaagctttctgaaaag
ctcggagttgaattgcatgtgaagacagagggcgttaatccgacgggctcctttaaagat
cgcggcatggtcatggcggtcgccaaagcgaaagaagaaggcaatgacacgatcatgtgc
gcctcaacgggcaacacctctgcggcggctgcggcatacgcggcgagagccggcatgaaa
tgcatcgtcatcattccggacgggaaaatcgccttcggaaagcttgcgcaggccgtcatg
tacggagcggaaatcatcgcgattgacggaaactttgacgacgcgctggccatcgtcagg
tcgatttgtgaaaaagctccgattgcattagtgaattcagtaaacccttaccggattgaa
gggcaaaaaacagcggcctttgaagtatgcgaacagctcggcggagcgccggacattctg
gcgatcccggtaggaaacgcagggaatatcacggcctattggaaagggttcaaagaatat
catgagaaaaacggcaccggacttccgaagatgcgcggctttgaggcggaaggttctgca
gctatcgtccgcggcgaggtcattaaaaatcctgaaaccgttgcaacggcaatccggatc
ggaaacccggccagctgggacaaagccgttctcgcagcaaaagaatcagccggaaaaatt
gatgaggtcacagatgaagaaattcttcatgcctatcagctgattgcccgtgaagaaggc
gtatttgccgagccgggctcctgtgcatccatcgccggcgttttaaaacaggtcaaatcc
ggtgaaattccaaaaggaagcaaggttgtcgcagtcttgaccggcaacggcctgaaagat
ccgaacacggctgtagacgtatctgaattaaaaccggtcacgctgccgacgaatgaagac
aatattctggaatacttaaatggagcggcgcgtgtatga

DBGET integrated database retrieval system