KEGG   Bacillus amyloliquefaciens XH7: BAXH7_03692Help
Entry
BAXH7_03692       CDS       T01836                                 

Gene name
gtaB
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bxh00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bxh00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bxh00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bxh00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3436137..3437015
Genome map
AA seq 292 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAVEAGIEDIIIVTGKS
KRAIEDHFDYSPELERNLEEKGKIELLEKVRKASNLADIHYIRQKEPKGLGHAVWCARNF
IGDEPFAVLLGDDIVQAEKPGLRQLMDEYEKTLSSIIGVQQVPEEETHRYGIIDPLTSEG
RRYQVKNFVEKPPQGTAPSNLAILGRYVFTPEIFMYLEEQQIGAGGEIQLTDAIQRLNEI
QRVFAYDFEGKRYDVGEKLGFITTTLEFAMQDHELRDHLIPFMEDLLRKDEL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaagtacgcaaagccataatccccgctgcaggtttagggacacgctttctgccg
gcaactaaagccatgccgaaagagatgcttccgattgtagacaaaccaactattcaatac
ataattgaagaagcggtagaagcgggtattgaagacattattattgttacgggaaaaagc
aagagagcaattgaagatcattttgattattcaccagagctcgaaagaaacctagaggaa
aaaggaaagattgaactcttagaaaaagtccgaaaagcctctaaccttgctgacattcat
tatatccggcaaaaggagccaaaaggtcttggacatgccgtttggtgcgcacgtaatttt
atcggtgacgagccattcgccgtccttctcggagatgatatcgttcaagcagagaaacca
ggacttcgtcagctgatggatgaatatgaaaaaacactttcttctattataggggttcag
caagtgcctgaggaagaaacccatcgatacggaattattgatccgctgacaagtgaaggc
cgcagatatcaggtgaagaactttgttgaaaagccgccgcaagggactgctccgtccaac
cttgcaatactgggacgttatgtcttcactcctgaaatcttcatgtatcttgaagaacag
caaattggtgccggaggagaaattcagcttacagacgctattcaaagactgaatgaaatc
caacgggtttttgcctacgattttgagggcaaaagatatgatgttggtgaaaaactaggc
tttattaccactacattagaatttgcgatgcaggatcatgaactgcgtgatcatctcatt
cctttcatggaagacctgttaagaaaagatgaattataa

DBGET integrated database retrieval system