KEGG   Bacillus amyloliquefaciens XH7: BAXH7_03919Help
Entry
BAXH7_03919       CDS       T01836                                 

Gene name
spsL
Definition
nucleotide sugar epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bxh00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BAXH7_03919 (spsL)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BAXH7_03919 (spsL)
Enzymes [BR:bxh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     BAXH7_03919 (spsL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3639918..3640379)
Genome map
AA seq 153 aa AA seqDB search
MQVIEGVKIKKLIKHSDDRGFFSELVRDDEQLLEHFGQASWSKSYPGVIKAFHYHEKQDD
LWFFPTGHAQVVLHDLREESATKGETDVYYMGEDNPMLLLIPKGVAHGYRVLGETPLTII
YFTTMSYNPDQPDEKRIPWNDETIGFDWKTAHR
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagtgatcgaaggcgtaaaaatcaaaaagctgatcaaacacagtgacgaccgaggt
tttttctcagaactcgtccgtgacgatgaacaacttctggaacatttcgggcaggcttcc
tggtcaaaaagctatcccggcgtcattaaagcgtttcactatcatgagaaacaggatgac
ctgtggtttttcccgacgggccacgcccaagtcgtgctgcatgaccttcgcgaagagtca
gcaaccaagggagaaacggatgtttactacatgggagaagacaatccgatgctgcttctc
attcccaaaggagtcgcgcacggttacagagtgctgggagaaaccccgctgactattatt
tattttacgacaatgtcctataatccggatcagcctgacgaaaaaagaatcccgtggaat
gatgaaaccatcggatttgactggaagacggctcatcggtaa

DBGET integrated database retrieval system