KEGG   Bacillus amyloliquefaciens XH7: BAXH7_04066Help
Entry
BAXH7_04066       CDS       T01836                                 

Gene name
bglH
Definition
aryl-phospho-beta-d-glucosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:bxh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAXH7_04066 (bglH)
Enzymes [BR:bxh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     BAXH7_04066 (bglH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3768545..3769942)
Genome map
AA seq 465 aa AA seqDB search
MKRFPEGFLWGGATAANQIEGAYKEGGKGLSTADVSPDGIMSPFHETDDALNLYHDAIDF
YHRYQEDIALFAEMGFKAFRTSIAWTRIFPNGDETEPNEEGLQFYDRLFDELRKHQIEPV
VTISHYEMPLGLVKNYGGWRNRQTVDFYERYARTVFTRYKDKVKYWMTFNEINVVLHAPF
TGGGLVFREGENKQNTMYQAAHHQFVASALAVKAGHEIIPDSQIGCMIAATTTYPMTPKP
EDVYAALQKERSTLFFSDVQARGSYPGYMKRFFKETGITIEMKEGDEELLKEHTVDYIGF
SYYMSMTASTAPEDLAQSKGNLLGGVKNPYLESSEWGWQIDPKGLRITLNTLYDRYQKPL
FIVENGLGAQDQPEEDGSIQDDYRIKYLRDHLIEAREAIEDGVNLIGYTSWGPIDLVSAS
TAEMKKRYGYIYVDRGNDGTGTFERKRKKSFYWYKDVIATNGESL
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaagagatttccggaaggttttttatggggcggcgcaacggctgccaatcagattgaa
ggagcttacaaagaaggcggcaaaggactttccacggcggatgtctccccggacggcatt
atgtcaccgttccatgagacagacgatgcgctgaatctgtatcacgacgcgattgatttt
tatcaccgctatcaagaggacatcgctctgtttgcggagatgggctttaaagcgttccgc
acctccattgcgtggacgagaatctttccgaacggcgatgaaacagagccgaatgaagaa
gggctgcaattttacgaccgtctttttgatgaattgagaaaacatcagatcgaaccggtg
gtcacgatttcgcactacgagatgccgctcggtctggtgaaaaattacggcggctggaga
aaccgccaaacggtcgatttctatgagaggtacgcccgcacggttttcacccgttataaa
gacaaggtgaaatattggatgacattcaatgaaatcaatgtcgttcttcacgctccgttt
acaggcggcggtctcgtattccgggaaggcgaaaataaacaaaacacgatgtaccaagcg
gcccaccaccagtttgtggcgagcgcgctggcggtaaaagccggccatgagatcatcccg
gattcacagatcggctgcatgatcgccgcgacgacgacgtatccgatgacgccgaagccg
gaggatgtatatgcggctttgcagaaagagcggagcacgctgttcttttctgatgtgcag
gcgaggggcagctatccgggctacatgaagcgcttctttaaagaaaccggaattacgatt
gagatgaaggaaggagacgaggagctcctgaaagaacacacggtggattacatcggcttc
agctactacatgtcgatgacggcaagcaccgcgcctgaggatctggcgcaatcgaagggg
aatcttctcggcggcgtgaaaaatccttatctggaatcttcggaatggggctggcagatt
gatccgaagggcttgcgcattaccttaaacacgctgtacgaccgttatcagaaaccgctc
ttcatcgtcgaaaacgggctcggcgcacaagatcagccggaggaagacggaagcatacag
gatgattaccgtatcaaatatctgcgggatcatttaatagaagcaagagaggcgatcgaa
gacggagtcaacctgatcggttacacgtcgtgggggccgattgacctcgtcagcgcctca
actgctgaaatgaaaaaacgctacggctatatctatgttgaccgcggcaatgacggaaca
ggcacgtttgaaaggaagagaaagaaaagtttttattggtataaagacgtcatcgcgaca
aatggagaaagtctgtaa

DBGET integrated database retrieval system