KEGG   Bacillus amyloliquefaciens XH7: BAXH7_04136Help
Entry
BAXH7_04136       CDS       T01836                                 

Gene name
fbp
Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
bxh00010  Glycolysis / Gluconeogenesis
bxh00030  Pentose phosphate pathway
bxh00051  Fructose and mannose metabolism
bxh00680  Methane metabolism
bxh01100  Metabolic pathways
bxh01110  Biosynthesis of secondary metabolites
bxh01120  Microbial metabolism in diverse environments
bxh01130  Biosynthesis of antibiotics
bxh01200  Carbon metabolism
Module
bxh_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bxh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAXH7_04136 (fbp)
   00030 Pentose phosphate pathway
    BAXH7_04136 (fbp)
   00051 Fructose and mannose metabolism
    BAXH7_04136 (fbp)
  Energy metabolism
   00680 Methane metabolism
    BAXH7_04136 (fbp)
Enzymes [BR:bxh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     BAXH7_04136 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: AEK91242
Position
3841170..3843095
Genome map
AA seq 641 aa AA seqDB search
METKYLDLLAQKYDCEEKVVTEIINLKAILNLPKGTEHFVSDLHGEYQAFQHVLRNGSGR
VKEKIRDIFSGVIYDREIDELAALVYYPEDKLKLIKHDFDTKEALNDWYEETIHRMIKLV
SYCSSKYTRSKLRKALPAQFAYISEELLYKTEQAANKEQYYSEIIEQIIALGQADKLITG
LAYSTQRLVVDHLHVVGDIYDRGPQPDKIMEELINYHSVDIQWGNHDVLWIGAYSGSKVC
LANIIRICARYDNLDIIEDVYGINLRPLLNLAEKYYDDNPSFRPKADENRPEDEIKQITK
IHQAIAMIQFKLESPIIKRRPNFNMEERLLLEKIDYDRNEITLNGKTYQLENTCFATVNP
KQPDELLEEEAEVMDKLLFSVQHSEKLGRHMNFMMKKGSLYLKYNGNLLIHGCIPVDENG
SMETMMIEDKAYAGRELLDVFERFLRNAFAHPEETDDLATDMVWYLWTGEYSSLFGKRAM
TTFERYFIKEKETHKEKKNPYYYLREDEATCRNILKEFGLNPDHGHIINGHTPVKEIEGE
DPIKANGKMIVIDGGFSKAYQSTTGIAGYTLLYNSYGMQLVAHKHFNSKAEVLSTGTDVL
TVKRLVDKELERKKVKETNVGEELLKEVAILEKLREYRYMK
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
ttggaaacgaaatatttagatctgctcgcacaaaaatacgattgtgaagaaaaagtggtc
acagaaatcataaatctgaaagcgatactgaacctgccgaaaggaaccgagcatttcgtc
agtgatttgcacggggagtatcaggcattccagcacgtgctgcggaatggttcaggaaga
gtaaaagagaagatccgcgatattttcagcggtgtcatttacgatagagaaattgatgaa
ctggcagctttggtctattatccggaagacaaactcaaattaatcaaacatgactttgat
acaaaagaagcattaaacgattggtatgaagaaacgattcatcgaatgattaagctcgtt
tcttattgctcttccaaatacacccgctccaaattgcgcaaggcgctgcctgcccaattt
gcttatatttctgaagagctgctgtacaaaacagaacaagccgccaacaaggaacaatat
tactccgaaatcatagaacagatcattgcgctcggccaagccgataagctgatcaccggt
cttgcatacagcacacagcgattggtggtcgaccatctgcatgttgtcggcgatatttac
gaccgcggaccccagcctgataaaattatggaagaactgatcaactatcattcagtggat
attcaatgggggaatcatgatgttctctggataggcgcctattccggctcgaaggtatgt
ctggccaatattatccgcatctgcgcccgctatgacaacctggatattattgaagacgtc
tacggcatcaacctgagaccgctcttgaacctggccgaaaaatattatgatgataacccg
tctttccgcccgaaagcggacgaaaacagaccggaagatgaaattaagcaaatcacaaaa
attcatcaggcgatcgcgatgatccaattcaagcttgagagcccgattatcaagagacgg
ccgaactttaatatggaggaacggctgttactggaaaagattgattatgaccgaaatgaa
atcacgctgaacggaaaaacatatcaactggaaaacacctgctttgcgacggttaatcca
aaacagccggatgagctattagaggaagaagcggaagtcatggacaagctgctgttctct
gttcagcattccgaaaagctgggccgccatatgaactttatgatgaaaaaaggcagcctt
tacttaaaatataacggcaacctattgattcacggctgtattcctgtcgacgaaaacggc
agcatggagacgatgatgattgaggataaagcctatgcgggccgtgagctgctcgatgta
tttgaacggttcttacggaatgccttcgcccacccggaagaaaccgatgatctggcgaca
gacatggtctggtatttatggacaggcgagtactcctccctcttcggaaaacgcgccatg
acgacctttgagcggtatttcattaaagagaaggaaacgcataaagaaaagaaaaacccg
tattactatttgcgcgaagacgaggcaacctgccgaaacatcctgaaagagttcggtctc
aacccggatcacggccatatcatcaacggccatacaccggtaaaagaaatcgaaggcgaa
gatccgatcaaagcaaacggaaaaatgatcgtcatcgacggaggcttctctaaagcctac
caatccacaacaggcatcgccggctacacgctcttatacaactcttacggcatgcagctc
gtcgcccataaacactttaactcaaaggccgaagtgctgagcaccggaaccgacgtctta
acagtgaaacgcttagtcgacaaagagctggagcggaagaaagtaaaagaaacgaatgtt
ggcgaggaactgctgaaggaagtggctattttggagaaactgcgggagtatcggtatatg
aagtga

DBGET integrated database retrieval system