KEGG   Bacteroides xylanisolvens: BXY_06060Help
Entry
BXY_06060         CDS       T02579                                 

Definition
D-xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
bxy  Bacteroides xylanisolvens
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bxy00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bxy00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(706721..708037)
Genome map
AA seq 438 aa AA seqDB search
MATKEFFPGIEKIKFEGKDSKNPMAFRYYDAEKVINGKKMKDWLRFAMAWWHTLCAEGGD
QFGGGTKQFPWNSNADAIQAAKDKMDAGFEFMQKMGIEYYCFHDVDLVSEGASIEEYEAN
LKAIVAYAKQKQAETGIKLLWGTANVFGHARYMNGAATNPDFDVVARAAVQIKNAIDATI
ELGGQNYVFWGGREGYMSLLNTDQKREKEHLAKMLTIARDYARARGFKGTFLIEPKPMEP
TKHQYDVDTETVIGFLKAHGLDKDFKVNIEVNHATLAGHTFEHELAVAVDNGMLGSIDAN
RGDYQNGWDTDQFPIDNYELTQAMMQIIRNGGLGNGGTNFDAKTRRNSTDLEDIFIAHIA
GMDAMARALESAAALLNESPYKKMLADRYASFDGGKGKEFEDGKLTLEDVVAYAKANGEP
KQTSGKQELYEAILNMYC
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaaaagaatttttcccgggaattgaaaagattaagttcgaaggtaaagatagt
aagaatccgatggcattccgttactacgatgctgaaaaggttatcaacggtaagaagatg
aaagattggttgagattcgctatggcatggtggcatactttgtgtgctgaaggtggcgac
caattcggtggcggaacaaaacaattcccttggaatagtaatgctgacgctatacaagct
gcaaaagataaaatggatgcaggtttcgaattcatgcagaaaatgggtatcgaatactac
tgtttccacgatgtagacttggtttctgaaggtgcaagcatcgaagaatacgaagctaac
ttgaaagcaatcgtagcatacgcaaaacagaaacaagctgaaacaggcatcaaactgttg
tggggtactgccaacgtatttggccatgcacgttatatgaacggtgctgctactaaccct
gattttgacgtagtagctcgtgctgctgttcagatcaagaatgcaatcgatgcaacgatc
gaactgggtggtcagaactatgtattctggggtggccgtgaaggctatatgtctcttctg
aatacagatcagaaacgtgaaaaagaacacttggcaaaaatgctgaccatcgctcgtgat
tatgctcgtgcccgtggtttcaaaggtactttcctgattgaaccgaaaccgatggaaccg
acaaaacatcagtatgatgtagatacagaaacagtaatcggattcctgaaagctcatggc
ttggataaagatttcaaagtgaacattgaagtaaaccacgcaactttggctggtcacact
ttcgaacacgaattggcagtagcagtagacaacggcatgttgggttctattgacgctaac
cgtggtgattatcagaatggttgggatacagaccaattcccgattgataactacgaactg
acacaagctatgatgcaaattatccgcaacggcggcttgggtaacggtggaacaaacttc
gacgctaaaactcgtcgtaactctactgacctggaagatatcttcatcgctcacatcgca
ggtatggacgctatggctcgtgcattggaaagcgcagctgctctgctgaacgaatctcca
tataagaaaatgttggctgaccgttacgcttcatttgatggcggtaaaggtaaggagttt
gaagatggcaagttgactttggaagatgtagttgcttatgctaaagcaaacggtgaaccg
aagcagactagcggtaaacaagagctttatgaagcaattctgaatatgtattgctaa

DBGET integrated database retrieval system