KEGG   Bacteroides xylanisolvens: BXY_06310Help
Entry
BXY_06310         CDS       T02579                                 

Definition
DNA ligase D, 3'-phosphoesterase domain (EC:6.5.1.1)
Orthology
K01971  
DNA ligase (ATP) [EC:6.5.1.1]
Organism
bxy  Bacteroides xylanisolvens
Pathway
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:bxy00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    BXY_06310
   03420 Nucleotide excision repair
    BXY_06310
   03430 Mismatch repair
    BXY_06310
   03450 Non-homologous end-joining
    BXY_06310
Enzymes [BR:bxy01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BXY_06310
DNA repair and recombination proteins [BR:bxy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BXY_06310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(735429..736046)
Genome map
AA seq 205 aa AA seqDB search
MAKNSPDEGKNIKMVEKQAVEASMINLKEYRAKRQFGKTPEPMADTVETPNRMPVFVVQK
HDASHFHFDFRLEVDGVLKSWVVPKGPSMNPKDKRLAIEVEDHPLSYAHFEGVIPEGNYG
AGTVEIWDSGTYAYVGNNRNISAAIKNGILEFKLHGHKLKGLFVLIHTNMDDQDKDWLLI
KKDDVFAATHVYDAKIIPSYDEVFL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaattctcccgatgaaggaaaaaacatcaaaatggtagaaaagcaggcggtt
gaagcctctatgattaacctcaaagagtaccgggcaaaaaggcaattcggtaaaacaccg
gaaccgatggcggatacggtggaaactcccaatcgaatgcctgtttttgttgttcagaag
catgatgccagtcattttcatttcgattttcgtttggaagtggatggagtattaaaaagt
tgggtggtgcctaaaggaccttccatgaatccaaaagataagaggttggccatagaagta
gaagaccaccccttgagttatgcgcactttgaaggagttataccggaaggtaactatgga
gcaggtacggtggaaatatgggatagtggaacctatgcttacgttggtaataatcgtaac
atttccgctgctattaaaaatggaatacttgaattcaagttacacgggcataaactcaaa
gggctatttgtccttatacataccaatatggatgatcaggataaagactggttgttgata
aagaaagacgatgtatttgcggccactcacgtttacgatgcaaagattattccgtcttat
gatgaggtattcctgtaa

DBGET integrated database retrieval system