KEGG   Bacteroides xylanisolvens: BXY_06310Help
Entry
BXY_06310         CDS       T02579                                 

Definition
(RefSeq) DNA ligase D, 3'-phosphoesterase domain (EC:6.5.1.1)
Organism
bxy  Bacteroides xylanisolvens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(735429..736046)
Genome map
AA seq 205 aa AA seqDB search
MAKNSPDEGKNIKMVEKQAVEASMINLKEYRAKRQFGKTPEPMADTVETPNRMPVFVVQK
HDASHFHFDFRLEVDGVLKSWVVPKGPSMNPKDKRLAIEVEDHPLSYAHFEGVIPEGNYG
AGTVEIWDSGTYAYVGNNRNISAAIKNGILEFKLHGHKLKGLFVLIHTNMDDQDKDWLLI
KKDDVFAATHVYDAKIIPSYDEVFL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaattctcccgatgaaggaaaaaacatcaaaatggtagaaaagcaggcggtt
gaagcctctatgattaacctcaaagagtaccgggcaaaaaggcaattcggtaaaacaccg
gaaccgatggcggatacggtggaaactcccaatcgaatgcctgtttttgttgttcagaag
catgatgccagtcattttcatttcgattttcgtttggaagtggatggagtattaaaaagt
tgggtggtgcctaaaggaccttccatgaatccaaaagataagaggttggccatagaagta
gaagaccaccccttgagttatgcgcactttgaaggagttataccggaaggtaactatgga
gcaggtacggtggaaatatgggatagtggaacctatgcttacgttggtaataatcgtaac
atttccgctgctattaaaaatggaatacttgaattcaagttacacgggcataaactcaaa
gggctatttgtccttatacataccaatatggatgatcaggataaagactggttgttgata
aagaaagacgatgtatttgcggccactcacgtttacgatgcaaagattattccgtcttat
gatgaggtattcctgtaa

DBGET integrated database retrieval system