KEGG   Bacteroides xylanisolvens: BXY_10390Help
Entry
BXY_10390         CDS       T02579                                 

Definition
Thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
bxy  Bacteroides xylanisolvens
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bxy00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BXY_10390
Enzymes [BR:bxy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BXY_10390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1191282..1191881)
Genome map
AA seq 199 aa AA seqDB search
MVLFSEDHIQETRRRGRIEVICGSMFSGKTEELIRRMKRAKFAKQRVEIFKPAIDTRYSE
EDVVSHDSHSIASTPIDSSASILLFTSEIDVVGIDEAQFFDSGLIDVCNQLANNGIRVII
AGLDMDFKGNPFGPMPQLCAIADEVSKVHAICVKCGQLASFSHRTVKNEKQVLLGETAEY
EPLCRECYLRARGEDEQKV
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggtattattttcagaagaccacatacaggagactagaagaagaggccggatcgaagta
atctgcggttccatgttctccggaaaaacagaggaattgattcgtagaatgaagagagcg
aaatttgcgaaacaacgtgtagagatattcaaaccggctatcgacacccgttattcagaa
gaagatgtagtctctcacgacagccattctatcgcctccactcccatcgattcgtcagcc
agtatcctactctttacttccgagatagatgtagtaggcattgacgaagcacagttcttc
gacagtggtttgattgatgtatgcaaccagctcgccaataatggaatccgtgttatcatt
gcagggttggatatggacttcaaaggaaatccgttcggaccaatgccgcaattgtgcgcc
attgccgatgaagtctccaaagttcatgcaatctgtgtgaaatgtggccagctggcttct
ttctcacatcgtactgtcaagaatgagaaacaggttcttttaggcgaaacagccgaatac
gagcctctgtgcagggaatgttatctccgcgcacgaggggaagatgagcagaaagtataa

DBGET integrated database retrieval system