KEGG   Bacteroides xylanisolvens: BXY_12340Help
Entry
BXY_12340         CDS       T02579                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase. (EC:1.3.99.5)
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
bxy  Bacteroides xylanisolvens
Brite
Enzymes [BR:bxy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     BXY_12340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1444885..1445646
Genome map
AA seq 253 aa AA seqDB search
MSIDTFNLFLGVMSLIALFVFIALYFVKAGYGIFRTASWGVAISNKLAWILMEAPVFMVM
CVMWIYSERRFEPVIFTFFLFFQIHYFQRAFIFPLLLKGKSKMPLAIMSMGVLFNLLNGY
MQGKWIFYLAPETMYQSGWFTSPWFIIGTLLFFAGMLLNWQSDYIIRHLRKPGDTRHYLP
QKGMYRYVTSANYFGEIVEWAGWAILTCSLSGLVFLWWTIANLVPRANAIWCRYREEFGD
AVGERKRVFPFLY
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagtatagatacttttaatctgtttctgggggtgatgagcctgattgctttgtttgtt
tttatcgccctttactttgtgaaagccggatatggtattttccgcacagcatcgtgggga
gtagctatctccaataaactagcctggatattgatggaagctccggttttcatggtgatg
tgcgtgatgtggatctactccgaacgtcggttcgagccggtgattttcactttcttcctc
ttctttcaaattcactattttcagcgtgctttcatcttccctttgctattgaaaggaaaa
agtaagatgccgctggcaatcatgtcgatgggagttctttttaatctgctgaatggttat
atgcaagggaaatggattttctatcttgctcccgaaacgatgtatcaatccggctggttc
acttcaccgtggtttattatcggcacactgctctttttcgcaggtatgctgttgaactgg
cagtcggattatatcatccgtcatttgcgcaaaccgggagacacccggcattatctgcct
caaaaaggaatgtaccgttatgtcacttccgccaactatttcggtgaaatagtagaatgg
gcaggttgggcgatactcacttgttcactttccggcctagtcttcctttggtggacgatt
gctaaccttgttccccgtgccaacgctatttggtgccgttaccgcgaagaattcggagac
gcagtgggagaacggaaacgagtgttccctttcctttattag

DBGET integrated database retrieval system