KEGG   Bacteroides xylanisolvens: BXY_18040Help
Entry
BXY_18040         CDS       T02579                                 

Definition
hexokinase (EC:2.7.1.1)
Orthology
K00844  
hexokinase [EC:2.7.1.1]
Organism
bxy  Bacteroides xylanisolvens
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Butirosin and neomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bxy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BXY_18040
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BXY_18040
   00051 Fructose and mannose metabolism
    BXY_18040
   00052 Galactose metabolism
    BXY_18040
   00500 Starch and sucrose metabolism
    BXY_18040
   00520 Amino sugar and nucleotide sugar metabolism
    BXY_18040
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BXY_18040
   00524 Butirosin and neomycin biosynthesis
    BXY_18040
Enzymes [BR:bxy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     BXY_18040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2132960..2134168)
Genome map
AA seq 402 aa AA seqDB search
MEKNIFQLDNEQLKEIARSFKAKVEEGLNTENAEIQCIPTFITPKASGINGKSLVLDLGG
TNYRVAIVDFSKMPPTIHPNNGWKKDMSIMKTPGYTREELFKEMADMITGIKREKEMPIG
YCFSYPTESIPGGDAKLLRWTKGVDIKEMIGEVVGKPLLDYLNERNKIKFTNIKVLNDTV
ASLFAGLTDSSYDAYIGLIVGTGTNMATFIPADKIKKLNPSHKVDGLIPVNLESGNFHPP
FLTAVDNTVDGISGNPGKQRFEKAVSGMYLGDILKTTFPLEEFEEKFDAQKLTSIMNYPD
IYKEVYVEVAQWIYSRSAQLVAASLTGLIMLLKSYNKNIRKICLVAEGSLFWSKNRKDKN
YNIIVMEKLRELFSLFGLEDVEVDIKSMNNANLIGTGIAALS
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaaatatttttcagttagataatgagcagctcaaagagattgctcgctcattt
aaagcgaaagtagaagaaggtttgaacactgaaaatgcagagatacaatgcattcccact
ttcatcactccgaaagcaagtggtatcaatggcaaatcattagtactcgacttgggagga
acgaattaccgggtagcaatcgttgacttcagcaaaatgcctcccaccattcatcctaac
aatggttggaaaaaggacatgtcgattatgaaaactcctggttatacccgagaggagttg
ttcaaagaaatggcagatatgataaccggaataaaacgggaaaaagagatgcctattgga
tattgtttttcttatccgacagagtccatcccaggtggagatgccaaactgctacgttgg
accaaaggagttgatataaaagagatgatcggagaagttgttggaaaacctttactcgac
tatctgaatgaaagaaataaaatcaagtttacgaacataaaagtgctcaatgacactgtt
gccagtttatttgccggacttaccgacagtagttacgatgcgtatataggtctgattgta
ggaacaggcaccaatatggcaacttttattccggctgacaaaattaaaaaattaaatccg
tcacataaagtagatggattgattcccgtcaatctggaatccggcaattttcatccgccg
tttctcactgcagtagataatacagtggatggaatctccgggaatccgggaaaacaacgt
ttcgaaaaagctgtatccggtatgtacctaggagatattctaaaaacaactttcccattg
gaggagttcgaagaaaagtttgatgcacaaaagctcacctctattatgaattatcccgat
atttataaggaggtgtatgtagaagtagcacagtggatatatagtagatcagcacagtta
gttgcagcttcactgacagggcttatcatgttgttgaagtcatacaacaagaatatacga
aaaatttgcctggttgccgaaggcagtcttttttggagcaagaacagaaaagacaagaac
tataacatcattgtcatggaaaaattacgggagcttttcagtttgtttggtttggaagat
gtagaggttgatatcaaaagcatgaataatgccaatttgatagggacaggtattgcggct
ttatcctga

DBGET integrated database retrieval system