KEGG   Bacteroides xylanisolvens: BXY_19520Help
Entry
BXY_19520         CDS       T02579                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bxy  Bacteroides xylanisolvens
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bxy00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BXY_19520
Enzymes [BR:bxy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BXY_19520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2307420..2308334
Genome map
AA seq 304 aa AA seqDB search
MDTKKKIVVIGSSNTDMVIKSDRLPKPGETILGGNFLMNHGGKGANQAVAAARLGGDVTF
ICKIGNDIFGNETLEMFHKEKIDTTYVGITPQEPSGVALINVDKKGENCIVVASGANGTL
SIDDIQHAEPAIKQASIVIMQLETPIESVTYAAKMAKKDGITVILNPAPAPTQQLPDELL
ANVDILIPNVTEAEIISGMHITDDESAKEAIRYISSKGIKTVIITMGAKGALAYENNEFI
HIPAFKVEAVDTTAAGDTFCGGLCVALSEGKNLKDAIIFASKASSISVTRMGAQVSIPLR
KEIQ
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggacacaaagaagaaaatcgtagtgataggtagtagtaatacggacatggttatcaaa
tcagaccgtctaccaaaaccaggagaaacaattctgggaggaaacttcttaatgaatcat
ggcggcaaaggagctaaccaagccgtagctgctgcaagactaggaggagatgtcactttc
atatgtaaaatagggaatgacatttttggaaatgaaaccttggaaatgtttcacaaagaa
aagatcgacactacttatgtaggaattaccccgcaggaaccgtcaggagtagctcttatc
aatgtcgacaaaaaaggggaaaactgtattgttgttgcttccggagccaacgggacttta
tctattgatgacatacagcatgcagaacctgccatcaaacaggcatccatcgtcatcatg
cagttggaaactccaatcgagagtgtcacttatgcagccaaaatggcgaaaaaagatgga
attaccgttatattaaatcccgcccctgcccctacccaacaactgcctgacgagttatta
gccaatgtcgacattcttattcctaatgtcacagaggctgaaatcatctcgggaatgcac
attacagatgatgaatcggcaaaagaagcgattcgttatattagttcgaaaggcataaaa
actgtcattattacgatgggagccaaaggagctctcgcctatgaaaacaatgagtttatc
cacattccagccttcaaggtagaagcagtagacacaaccgctgccggagatacattctgc
ggcggattgtgcgtagctctgtctgagggcaaaaatctaaaagatgcaattatatttgca
agtaaagcctcttctatttctgttaccagaatgggagcacaagtatctatacctttgaga
aaagaaatacaataa

DBGET integrated database retrieval system