KEGG   Bacteroides xylanisolvens: BXY_21090Help
Entry
BXY_21090         CDS       T02579                                 

Definition
Cellulase (glycosyl hydrolase family 5). (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bxy  Bacteroides xylanisolvens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bxy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BXY_21090
Enzymes [BR:bxy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BXY_21090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2525457..2526440
Genome map
AA seq 327 aa AA seqDB search
MKMKKVILFITLFSMISLFSYSKDPVKQWGQLQVKGNQLCSQTGDPIVLRGVSYGWHNLW
PRFYNKQSVKWLKKDWKCTVLRAAMGTVIEDNYIENPEFALKCMNKVIKAAIKNDLYIII
DWHTYYPQKKEAKAFFSMMAQKYGKYPHIIYEIYNEPMEDSWESVKEYATDIISEIRKYD
PDNIILVGSPHWDQDLHLVAESPLEGSDNIMYTLHFYAATHKQELRDRAEAAWEKGIPIF
VSECAGMECTGDGPLDIPEWTRWVEWLESKKISWVNWSISDKNETCSMILPRANKNGGWD
ESLIKPAGRQSRKFIRQYNSHIYKNKE
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgaagaaagtcattttgtttatcaccttattctccatgatatcattattcagt
tacagtaaagatcctgtaaaacaatggggacaactacaagtaaaaggtaatcaattatgc
agccaaaccggagaccctattgtattaagaggggttagttatggctggcacaacctatgg
cccagattttacaataagcaatctgtgaaatggttgaaaaaagattggaaatgtaccgtt
ttacgcgccgccatgggaacagttattgaagacaactacattgaaaatccggaatttgca
ttaaaatgcatgaataaagtgattaaagcggcaattaaaaacgacctctatataataatc
gactggcatacttattatccacaaaaaaaagaagcaaaagcatttttctcaatgatggca
cagaaatacggaaaatatcctcatattatttatgaaatatacaacgaacctatggaagac
agttgggaaagtgtgaaagaatatgcaactgatattatctctgaaatacgtaaatatgat
cctgataatattattcttgtaggcagcccacactgggaccaagacttacacctggtagca
gaaagtcctttagaaggatccgataatataatgtataccctccatttctatgccgccact
cataaacaagagttacgggatagagctgaagcagcatgggaaaaaggaattcccattttt
gtgtctgaatgtgcaggcatggaatgtactggcgatggcccattagatataccagaatgg
acccgttgggtagaatggctggaaagcaaaaagatcagctgggttaactggtccatttca
gacaagaacgaaacttgctccatgattcttccgcgagcaaacaaaaacggaggatgggac
gagtctttaataaaacctgcaggacgtcaaagccgtaagtttatccgacaatacaactca
catatttataaaaataaagaatga

DBGET integrated database retrieval system