KEGG   Bacteroides xylanisolvens: BXY_21090Help
Entry
BXY_21090         CDS       T02579                                 

Definition
Cellulase (glycosyl hydrolase family 5). (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bxy  Bacteroides xylanisolvens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bxy00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2525457..2526440
Genome map
AA seq 327 aa AA seqDB search
MKMKKVILFITLFSMISLFSYSKDPVKQWGQLQVKGNQLCSQTGDPIVLRGVSYGWHNLW
PRFYNKQSVKWLKKDWKCTVLRAAMGTVIEDNYIENPEFALKCMNKVIKAAIKNDLYIII
DWHTYYPQKKEAKAFFSMMAQKYGKYPHIIYEIYNEPMEDSWESVKEYATDIISEIRKYD
PDNIILVGSPHWDQDLHLVAESPLEGSDNIMYTLHFYAATHKQELRDRAEAAWEKGIPIF
VSECAGMECTGDGPLDIPEWTRWVEWLESKKISWVNWSISDKNETCSMILPRANKNGGWD
ESLIKPAGRQSRKFIRQYNSHIYKNKE
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgaagaaagtcattttgtttatcaccttattctccatgatatcattattcagt
tacagtaaagatcctgtaaaacaatggggacaactacaagtaaaaggtaatcaattatgc
agccaaaccggagaccctattgtattaagaggggttagttatggctggcacaacctatgg
cccagattttacaataagcaatctgtgaaatggttgaaaaaagattggaaatgtaccgtt
ttacgcgccgccatgggaacagttattgaagacaactacattgaaaatccggaatttgca
ttaaaatgcatgaataaagtgattaaagcggcaattaaaaacgacctctatataataatc
gactggcatacttattatccacaaaaaaaagaagcaaaagcatttttctcaatgatggca
cagaaatacggaaaatatcctcatattatttatgaaatatacaacgaacctatggaagac
agttgggaaagtgtgaaagaatatgcaactgatattatctctgaaatacgtaaatatgat
cctgataatattattcttgtaggcagcccacactgggaccaagacttacacctggtagca
gaaagtcctttagaaggatccgataatataatgtataccctccatttctatgccgccact
cataaacaagagttacgggatagagctgaagcagcatgggaaaaaggaattcccattttt
gtgtctgaatgtgcaggcatggaatgtactggcgatggcccattagatataccagaatgg
acccgttgggtagaatggctggaaagcaaaaagatcagctgggttaactggtccatttca
gacaagaacgaaacttgctccatgattcttccgcgagcaaacaaaaacggaggatgggac
gagtctttaataaaacctgcaggacgtcaaagccgtaagtttatccgacaatacaactca
catatttataaaaataaagaatga

DBGET integrated database retrieval system