KEGG   Bacteroides xylanisolvens: BXY_21130Help
Entry
BXY_21130         CDS       T02579                                 

Definition
Endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bxy  Bacteroides xylanisolvens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bxy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BXY_21130
Enzymes [BR:bxy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BXY_21130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2532848..2533933
Genome map
AA seq 361 aa AA seqDB search
MLKDLFSLLTIIALLFSSCSKSDEEENGDEPQPTKQTAYFGVNLSGAEFGNVYPGVDGTH
YGYPTEKDLDYFKAKGLYLVRFPFRWERIQPTMNGELNATELAKMKKFVKAAEDRNIQIL
LDMHNFGRYCVYCDGQSSQNNQYAIIGNARCTVDNFCDVWKKLAKEFKDYKNIWGYDIMN
EPYEMLASTPWVNIAQACINAIRTIDTKTTIIVSGDEFSSARRWKECSDNLKTLTDPSNN
LIFQAHIYFDSDSSGNYNKGYDEDGATVQTGVARLKPFVDWLKENNKRGFVGEYGIPDTD
GRWLDILDAALKYLQENGINGTYWSAGPRWGDYPLSVQPTNNYTQDRPQLSTLLKYKSTQ
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaagacttattttcattattaacgattatagcacttctattttcatcttgttcc
aaatcagacgaagaagaaaatggtgatgaacctcaaccaaccaaacaaacagcttatttc
ggagttaacctgtcaggagctgaatttgggaatgtatatccgggggtagatggtactcac
tatggttatcccacagaaaaagacttggattactttaaagccaaaggtctttatctggta
cgttttccatttcgttgggaacgcatacaacccacaatgaatggagaattaaatgcaaca
gaactggcaaaaatgaagaaattcgtcaaagctgccgaagatagaaacatacagatacta
ttggatatgcataactttggaagatattgtgtatattgcgacgggcaaagttcacaaaat
aatcaatatgcaatcattggtaatgcacgatgcactgttgacaatttctgtgacgtatgg
aaaaaactggcaaaggagtttaaagactataaaaatatctggggttacgacattatgaat
gaaccctacgaaatgctggcatcgacaccgtgggttaacatagcccaagcttgcattaat
gccatccgcactatagatactaaaacaaccatcatagttagcggagacgaattcagttct
gccagacgatggaaagaatgcagtgacaatctgaaaactcttacagatccaagtaataac
ctgatattccaggcacatatatatttcgattcggattcttccggaaactataataaagga
tatgatgaagatggtgcaaccgttcaaacaggggtggctcgtttgaaaccttttgttgac
tggctgaaagagaataataaacgtggattcgtcggtgaatatggaatacctgatactgac
ggtcgttggctggatattcttgatgcagcacttaaatatctacaagaaaatggaataaac
ggaacttattggtctgccggtccacgatggggtgattatcccttatctgtccaaccgacc
aataattacacacaggatcgtccgcaattaagcacgctcctgaaatataaaagtacacaa
caataa

DBGET integrated database retrieval system