KEGG   Bacteroides xylanisolvens: BXY_21150Help
Entry
BXY_21150         CDS       T02579                                 

Definition
Endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bxy  Bacteroides xylanisolvens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bxy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BXY_21150
Enzymes [BR:bxy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BXY_21150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2536533..2537573
Genome map
AA seq 346 aa AA seqDB search
MKKVFISAFLLLSLLTLNGCKSNQPPVKETGEPYGVNLACADFGSSFPGEYNKDYTYPTD
QDLEYWQKKGLKLIRLPFKWERLQLDLKGPLNQHDLNKMKELVRAAEKRDMVVLLDLHNY
CRRYMNNEHTLIGNNGLTIGDLASFWQAIAKEFSTFKNIYGYGLMNEPHDLTPETSWFDM
AQASINAIREVDTNTLIMVGGNDWSSAERWIEQSDTLKYLKDPANNLAFEAHVYFDKDAS
GTYKYSYEEEECYPEKGIDRVKPFVEWIKQNKFHGFIGEYGIPDNDPRWNETLDLFLGYL
QENGINGTYWAAGPWWDSYFMAITPKDGKDRPQMPIIEKYTSTLKK
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtttttatttcggcttttctactactcagccttcttactctaaatggatgt
aaaagtaatcaacctccagtaaaagagacaggtgaaccttacggagtaaacttggcatgt
gctgacttcggttcatcctttcccggggaatataataaagactatacctacccgacagac
caggacctcgaatattggcaaaagaaagggctgaaacttatccggttgccattcaaatgg
gaacggctacaacttgacttaaaaggaccgctaaaccaacatgacctcaataaaatgaaa
gaactggtcagagctgcagagaaacgcgatatggtggttcttcttgacttacataattac
tgtcgccgttacatgaacaacgaacataccctcattggaaataacggattaacgatcgga
gacttggcttctttctggcaagctatcgctaaagaattctcgacttttaaaaacatatat
ggttatgggctaatgaacgagccacatgatctgaccccggaaaccagctggttcgacatg
gcacaagcgtccatcaatgccattcgggaggtcgacacaaatactcttatcatggtaggc
ggcaatgactggtcatcagcagagcgctggattgaacagagtgatacactcaaatattta
aaagacccggctaataaccttgcttttgaagctcatgtatattttgacaaggatgcatcc
ggtacctacaaatattcatacgaagaggaagaatgttatccggagaaaggtatcgaccgg
gtaaaaccatttgtagaatggatcaaacaaaataaatttcatggttttatcggagaatat
ggaattcccgacaatgatccccgttggaatgaaaccctcgacttattcttgggatattta
caagaaaacggaatcaatggtacatattgggctgcgggtccgtggtgggatagctatttc
atggcaattacccccaaagacgggaaagacagaccgcaaatgcctatcattgagaaatat
acaagtaccttaaaaaaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system