KEGG   Bacteroides xylanisolvens: BXY_23620Help
Entry
BXY_23620         CDS       T02579                                 

Definition
Uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bxy  Bacteroides xylanisolvens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bxy00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2899944..2900435
Genome map
AA seq 163 aa AA seqDB search
MKYFCVTEAVALYIQKYVQYRKRKIFFGATGKIEDLIPSIVKHKTEKYLVPMSDVHNDDV
KNLLDKNNIQHTEAVMYRTVSNDFTPDEEFDYDMLVFFSPAGVTSLKKNFPDFNQREIKI
GTFGSTTAQAVRDAGLRLDLEAPTVQAPSMTAALDMFIRENNK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatttctgcgtgacggaagctgttgcattgtatattcagaaatatgtgcaatac
cgcaagcgtaagatcttcttcggagctaccggaaagattgaggacctgataccttccatt
gtgaagcataaaacggagaaatatctcgttccgatgtcagacgtacacaatgacgatgtg
aaaaacttgctcgacaagaataacattcagcatacagaagctgtgatgtaccgtacagtg
agcaacgactttacaccggacgaggagtttgattatgacatgttagtgttcttcagccct
gccggagtgacttcattgaagaagaacttccctgattttaatcagagagagattaagatc
ggcactttcggctctactaccgcacaggctgtacgtgacgcaggtctccgtctggacctt
gaagctcctacggtgcaggctccgtcaatgactgccgcacttgatatgtttatcagagaa
aacaataaataa

DBGET integrated database retrieval system