KEGG   Bacteroides xylanisolvens: BXY_25640Help
Entry
BXY_25640         CDS       T02579                                 

Definition
O-Glycosyl hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
bxy  Bacteroides xylanisolvens
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bxy00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BXY_25640
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BXY_25640
Enzymes [BR:bxy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     BXY_25640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3117304..3118383
Genome map
AA seq 359 aa AA seqDB search
MIDMRNIALTFLGCFTILAACSNSDDAEKPVTPVPTGDVTIYATTSSLTRDLTRDAVNFS
SKDNLAPTSITLNPTEQYQTMDGFGAAITGATCFNLLQMKPEDRHAFLTETFSDDKGFGF
SYIRISIGCSDFSLSEYTCCDTKGIEHFALQSEEKDYILPILKEILSINPSIKVIAAPWT
CPKWMKVKSLTDLTPLDSWTNGQLNPAYYQDYATYFVKWVQAFNAEGIDIYAVTPQNEPL
NRGNSASLYMSWEEQRDFVKTALGPKFKTAGLATKIYAYDHNYDYSDIATEKNYPGKMYE
DAAASQYLAGAAYHNYGGNREELLNIHTKPILKRNFFSRRLLSEHGIADVICRNDCWKI
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgatagacatgagaaatatagcattgacctttttaggatgcttcaccatattagctgca
tgcagcaacagtgacgatgcggagaaaccggttacacctgttccgaccggagatgtgact
atttatgcgaccactagcagcctgactcgcgatttgacccgtgatgccgttaatttcagc
tcgaaagataatttggcacctacttcaatcacattgaatccgactgaacaatatcagaca
atggatggcttcggagctgctatcacaggcgccacttgttttaatcttctgcaaatgaaa
ccggaagatcgtcacgccttccttacggaaacattctctgacgacaaaggcttcggattt
agctatatccgtatctctatcggctgctcggacttttcattgagcgaatatacctgctgt
gatacgaaaggtattgagcattttgctttgcaaagtgaagagaaagactatatccttccg
attctgaaagagattttgagcatcaatccttctattaaagtcattgccgccccttggact
tgtccaaaatggatgaaagtaaagagtctcacagatcttactccgctggattcatggaca
aacggtcagctgaatccagcctattatcaggactatgccacttattttgtgaaatgggta
caagccttcaacgccgaaggcattgatatttatgctgtaactccccagaacgaaccgttg
aaccgtggtaattccgcttcactttatatgagttgggaagaacagagggactttgtgaaa
acagcactcggacctaaattcaaaacagccggactggctacgaaaatttatgcatacgat
cataactatgattatagtgatattgcaacggaaaagaactaccccggtaagatgtatgag
gacgcagctgcttcccaatacctggccggagctgcttatcacaactatggcgggaatcgc
gaagagcttttaaatatacatacaaagcctatcctgaaaaggaacttcttttcacggaga
cttctatcggaacatggaatagcggacgtgatttgtcgaaacgattgctggaagatatga

DBGET integrated database retrieval system