KEGG   Bacteroides xylanisolvens: BXY_30600Help
Entry
BXY_30600         CDS       T02579                                 

Definition
Alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bxy  Bacteroides xylanisolvens
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bxy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BXY_30600
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BXY_30600
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BXY_30600
Enzymes [BR:bxy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BXY_30600
Exosome [BR:bxy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BXY_30600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3790223..3791344
Genome map
AA seq 373 aa AA seqDB search
MDAEKNHGLKSLARQLKDKGYKIGIITSASIDHATPGGFYASQPDRSMYYEIGVDAANSG
FDFFGGAGLLEPRSKRNLSAPCLYDLFNQKGYTMFRGMDAYNRAAAKDKILLFPTDTVSK
SLKYAMDRSAKDLSLPDLTKACLANFQETAKKGFFMMVEGGKIDWAAHAHDGGAVVKETI
DFDQCIRLAYDFYKKHPNETLILVTADHETGGLGLGNSDMNLNIDLLQYQKCSQEALTAA
MREMKSGKMIPSWKDMKAFLKKNLGFWEQIKITPREELELLVCYEESFLKKKSKDVVSLY
AKDEPLAVAAIALLDKKASLGWTTKTHTGAPVPLYAIGKQAVLYSGRRDNTDMANVLRKL
FLIKYGEVYQSRM
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggatgcggaaaagaatcacgggttaaaatccctggcacgccaactgaaagataaaggt
tataaaataggaataatcacttctgcttctatcgaccacgctacccccggtggattttat
gcttcacaacccgaccgttctatgtattacgaaataggagtggatgccgccaattccggt
ttcgatttcttcggtggggcgggattgctcgaacctcgcagcaagcgtaacctttcggcg
ccttgcctttatgacctgttcaatcagaaaggctatacgatgtttcgtggaatggacgct
tataaccgtgctgctgcaaaggataaaattctcctcttcccaaccgatacagtgagcaaa
agcctgaaatatgcgatggaccgttccgccaaagacttgagtttgcctgacttgacaaaa
gcctgccttgctaattttcaggaaaccgcgaagaagggtttctttatgatggtagaaggc
ggaaaaatagattgggcggcccatgcccacgacggtggcgctgttgtgaaagaaaccatt
gacttcgaccaatgtatccgcttggcttatgatttctacaaaaagcatccgaacgagaca
ttgatattagtgactgccgaccacgaaacgggcggtcttggactgggcaactccgatatg
aacctgaatatcgacttgcttcaatatcagaagtgttcacaagaagccttgactgctgct
atgcgtgaaatgaaaagcggaaagatgattccttcgtggaaagacatgaaagcgtttctg
aaaaagaacctgggcttttgggaacaaattaagattactccgcgtgaagaacttgaatta
ttggtttgctacgaagagtctttcttgaagaagaagtcgaaagatgtggtcagcctttac
gcgaaagatgaacctttagcggtggctgctattgccttgttggataagaaggcgtcattg
ggatggacaactaaaacgcatacgggagcacccgtgccattgtatgcgataggcaagcag
gctgttctttattcgggcaggagagacaatacggatatggctaatgttttgcggaaatta
ttccttatcaaatatggagaggtttatcaatcaagaatgtga

DBGET integrated database retrieval system