KEGG   Bacteroides xylanisolvens: BXY_31920Help
Entry
BXY_31920         CDS       T02579                                 

Definition
Pectin methylesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
bxy  Bacteroides xylanisolvens
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bxy00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bxy00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3990099..3991070
Genome map
AA seq 323 aa AA seqDB search
MKRSIFKGMMCLLLLGVGATSVYAQQQQRKDTLVVARDGTGEYRNIQEAVEAVRAFMDYT
VTIYIKNGIYKEKLVIPSWVKNVQLVGESAEKTIITYDDHANINKMGTFRTYTVKVEGND
ITFKDLTIENNAAPLGQAVALHTEGDRLMFVNCRFLGNQDTIYTGTEGARLLFTNCYIEG
TTDFIFGPSTALFEYCELHSKRDSYITAASTPQSEEFGYVFKNCKLTAAPGVKKVYLGRP
WRPYAATVFINCEFGNHIRPEGWHNWKNPENEKTARYAEFGNTGAGADTSGRVAWAKQLT
NKEAMKYTPQNIFKESSNWYPYK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggagtatttttaaaggaatgatgtgtttgcttctactgggtgtgggagcaaca
tctgtttatgcacagcaacagcaacgcaaagacacattagtcgtggcacgcgacgggaca
ggggagtatcgtaacattcaggaagccgtggaagctgtccgcgcttttatggattatacg
gtgacgatctatatcaagaatggtatatacaaagaaaagctggtcattccttcctgggtg
aagaatgtgcaattagtgggcgaaagcgcagaaaaaacgattatcacttacgatgaccat
gctaatataaataagatgggtaccttccgcacctatacggtcaaagtggaagggaatgac
atcactttcaaagacctgacgattgaaaataatgcggctccactggggcaagcggtagct
cttcacaccgaaggtgacagactgatgtttgtcaactgtcgtttcttgggaaatcaggat
actatttatacaggaaccgaaggagcgcgccttctattcacgaattgctatatcgaggga
actaccgattttatttttggcccttccaccgctctattcgaatattgtgaactgcatagt
aaacgtgattcgtatatcactgccgcttccactcctcaaagtgaagaattcggttatgtt
ttcaaaaactgtaagttgacagccgctccgggagtgaaaaaagtatatttgggtcgtccg
tggcgtccttatgcggcaacggtctttatcaattgtgagtttggtaatcatatccgtccc
gaaggatggcacaattggaagaatccggagaacgaaaagacagcccgttatgccgaattc
ggaaatacgggtgcgggcgcagatacttccgggcgtgtggcatgggctaaacagttgaca
aataaggaggcaatgaagtatactccgcaaaatatctttaaggaaagcagtaattggtat
ccctataaataa

DBGET integrated database retrieval system