KEGG   Bacteroides xylanisolvens: BXY_42090Help
Entry
BXY_42090         CDS       T02579                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
bxy  Bacteroides xylanisolvens
Pathway
bxy00340  Histidine metabolism
bxy01100  Metabolic pathways
bxy01110  Biosynthesis of secondary metabolites
bxy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bxy00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    BXY_42090
Enzymes [BR:bxy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     BXY_42090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: CBK69112
UniProt: D6D3W0
Position
5161349..5162638
Genome map
AA seq 429 aa AA seqDB search
MRLIKYPSKEQWTELLKRPALNTENLFDTVRSIINKVRAEGDKAVLEYEATFDKVALSAL
AVTPEEIQVAGTLVSDELKAAISLAKQNIETFHASQRFIGKKVETMNGVTCWQKSVGIEK
VGLYIPGGTAPLFSTVLMLAVPAKIAGCKEIVLCTPPDKNGNIHPAILFAAQLAGVSKIF
KAGGVQAIAAMAYGTESVPKVYKIFGPGNQYVTAAKQLVSLRDVAIDMPAGPSEVEVLAD
ASANPVFVAADLLSQAEHGIDSQAILITTSEKLQTEVMAEVERQLAELSRREIAAKSLEN
SKLILVKDLDEALELTNAYAPEHLIIETENYMEVAERVTNAGSVFLGSLTPESAGDYASG
TNHTLPTNGYAKAYSGVSLDSFIRKITFQEILPEGIKAIGPAIEEMAANEHLDAHKNAVT
VRLKAIQNS
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagattgattaaatatccctcaaaagaacagtggacggaacttttgaaacgtccggca
ctgaatacggaaaatttgttcgacactgttcgctctattataaataaggtaagggcagaa
ggtgacaaagccgtcttggaatatgaagctacttttgataaagtcgccttgtctgcgctt
gctgtgactcctgaagagatacaggttgccggaacattggtaagcgatgaactgaaagca
gccatctccctggcaaaacaaaatattgaaacctttcatgcttcccaacgttttatcgga
aagaaggtagaaacaatgaacggtgtgacttgctggcaaaaatcggtaggaatcgaaaaa
gtgggattgtatattccgggtggaacagcaccacttttctcaactgtattgatgttggct
gttccggctaaaattgcaggatgcaaggaaatcgtactttgcacgcctcccgataagaat
ggaaatattcatccggctattctttttgctgcgcaactggcaggtgtcagtaaaatattc
aaggctggtggtgtgcaggctattgccgctatggcctatggaacggagagtgtccccaaa
gtatataagatatttggtccaggcaatcaatatgtgacagctgccaaacagttggtaagc
ctgcgtgatgtagctattgatatgcctgccggcccttctgaagtcgaagttctggctgat
gcatctgccaacccggtttttgtagcagcagatcttttgtcacaggcagaacacggaata
gatagccaggctatattgattaccacttccgagaagcttcaaacagaagtaatggcggaa
gtagaacgtcaattagccgaattatcccgtcgtgaaattgctgcaaagtcattagagaat
agtaaactgattttagtaaaggatttggatgaagcattggaactgactaacgcatacgcg
ccggaacacttaatcatagaaacggaaaactacatggaagtagcagagcgtgtaacaaat
gccggttctgtttttcttggatcgttaactcccgaaagtgccggtgactatgcttccgga
acaaatcataccttgcctaccaacggttatgccaaagcatatagcggcgtcagtctggat
agttttatccgcaagattacgttccaggaaattctcccggaaggaataaaggctattggt
cctgctattgaagagatggcggctaacgaacatttggacgcgcataagaatgcggtcaca
gttcgtctcaaagcaattcaaaattcataa

DBGET integrated database retrieval system