KEGG   Bacteroides xylanisolvens: BXY_47800Help
Entry
BXY_47800         CDS       T02579                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bxy  Bacteroides xylanisolvens
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bxy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BXY_47800
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BXY_47800
Enzymes [BR:bxy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BXY_47800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5836475..5837557)
Genome map
AA seq 360 aa AA seqDB search
MKQEFTRIAVKVGSNVLTRRDGTLDVTRMSALVDQIAELHKSGVEIILISSGAVASGRSE
VHPQKKLDSVDQRQLFSAVGQAKLINRYYELFREHSIPVGQVLTTKESFGTRRHYLNQKN
CMTVMLENNVIPIVNENDTISVSELMFTDNDELSGLIASMMDAQALIILSNIDGIYNGSP
ADPGSFVIRKIDHGKDLSNYIQATKSSFGRGGMLTKTNIARKVADEGITVIIANGKRDNI
LVDLLQHPKETLCTRFIPSNEPVSSVKKWIAHSEGFAKGEIHINECATEVLNSEKAVSIL
PIGITHVEGEFEKDDIVRIMDFQGNQVGVGKVNCDSKQVQEAIGKHGKKPVVHYDYLYIE
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaggaatttacacgaatcgcagtaaaagtaggaagcaatgtattgacacgccgc
gacggaacgctggacgttacccgtatgtcggcacttgttgaccagatagcggaattacat
aaatccggggtggaaatcattctgatttcttcaggagctgttgcttccgggcgcagtgaa
gtgcatccacagaaaaagctcgatagtgtagaccaacgccagttgttttctgccgtaggt
caggctaagctcatcaaccgttactacgaacttttccgcgagcatagtattcctgttggt
caggtgttgaccacgaaagaaagttttggtacccgccgccattatctgaatcagaaaaac
tgtatgacggtaatgcttgaaaataatgttattcctattgtcaacgagaatgatacaatt
tccgtcagcgagcttatgttcactgataatgatgaattgtccggactcatcgcttccatg
atggatgcacaggctctcattatcctaagcaacatcgacggaatttacaatggttctcct
gctgatccgggttcttttgttatccggaagatcgatcacggaaaagatttatccaattat
attcaggcaactaagtccagtttcggacggggaggaatgttgacgaaaacaaatattgcc
cgcaaagtagctgatgaaggaattacagtgattattgccaacgggaaacgggataatatt
ctggtagatttgcttcagcatccgaaagaaacgctttgtacacgttttatcccttcaaat
gaaccggtatccagtgtcaaaaaatggattgctcatagcgaggggtttgccaaaggagaa
attcacatcaacgaatgtgcgacagaagttctaaactctgaaaaggctgtcagcatcctc
cccatcggaattactcacgttgaaggtgaatttgagaaagatgacattgtgcgtatcatg
gactttcaaggaaatcaagtgggcgttggaaaggtgaactgcgattccaaacaggtgcaa
gaagcaatcggtaagcatggaaagaaaccggtagtacattatgactatctatacattgaa
taa

DBGET integrated database retrieval system