KEGG   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2: BANAU_0079Help
Entry
BANAU_0079        CDS       T02050                                 

Gene name
folK
Definition
7,8-dihydro-6-hydroxymethylpterin pyrophosphokinase FolK (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bya  Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bya00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
87923..88426
Genome map
AA seq 167 aa AA seqDB search
MNNTAYIGLGSNMGDREHYLRQAVAMLSRHHGLTVSKVSSIYETDPVGYEDQDQFLNMAV
EVKTSLSPFELLDVTQSIEAELGRTREIRWGPRTADLDILLYNRENIETERLIVPHPRMY
ERLFVLAPLKEICPQADHITISAETNQEGVRVWKQKSGVGEFVHSES
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatacggcatatatcggcctcggttccaatatgggcgaccgtgaacattatttg
cgccaggcagtggccatgctcagccggcatcatggtttgacggtgtcaaaggtgtcctcc
atatatgaaacagatcccgtcggctatgaggatcaagatcagtttctcaatatggcggtt
gaagtgaaaacgtcgttatctccttttgaacttcttgatgtaacgcagagcattgaagct
gaattaggcagaacgagagagattcgctggggaccgcggacggcagaccttgacattttg
ctgtataatcgtgaaaatattgaaacagagcggctgattgttccgcatccgagaatgtat
gagcgcttatttgtccttgcgccgttaaaagaaatatgtccgcaggcggatcatatcacg
ataagcgctgaaacaaaccaagaaggtgtaagagtatggaagcagaaatctggggtaggc
gaattcgtgcattcagaaagctga

DBGET integrated database retrieval system