KEGG   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2: BANAU_0226Help
Entry
BANAU_0226        CDS       T02050                                 

Gene name
ybgJ
Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bya  Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bya00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bya00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:bya00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(255363..256346)
Genome map
AA seq 327 aa AA seqDB search
MKDMVRERLEKEELASLLQDWVEHYRPFSVNGKSANYIPALGEINDSQLGICILEPDGSM
IHAGEWNVPFTLQSISKVISFIAACMNRGISYVLDRVDVEPTGDAFNSIIRLEIHKPGKP
FNPMINAGAITVASLLPGETAHDKLEYLFSVFEKLIGKRPHVHEEVFRSEWQTAHRNRAL
AYYLKETNFLEADVEETLEVYLKQCAMEGTTEDIALIGLILAHDGYHPIRREQVIPKDVA
KLAKALMLTCGMYNASGKYAAFVGVPAKSGVSGGIMALVPPSARREQPFHNGCGIGIYGP
AIDEYGNSLTGGMLLKHIAQEWELSIF
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatatggtcagagagcgccttgaaaaagaggaactggcttcacttttacaagat
tgggtcgagcattaccgaccgttttccgtcaatggaaaaagcgcaaattatatacccgcc
ctcggagaaatcaacgactctcagctgggcatttgcatattagagccggatggctcaatg
attcatgccggtgaatggaatgtcccgttcacattgcagagcatctcaaaagtcatcagc
tttattgccgcctgcatgaacagaggcatttcttacgtgctggatcgtgtggacgtggaa
ccgacgggtgatgcgtttaattctatcatccggcttgaaatccataaacccgggaagccc
ttcaacccgatgatcaatgccggcgccattaccgtcgcctcgctgcttccgggtgaaacg
gcgcatgataaattagaatatctcttttccgtttttgaaaaattaataggaaaacgccct
cacgttcacgaggaggtcttccgttctgaatggcagaccgcgcatcggaaccgagcgctc
gcctactatttaaaagaaacgaactttctcgaggcggatgtggaagaaacgcttgaagtg
tatttaaagcagtgcgccatggagggtacaaccgaggacatcgctttaatcggattgata
cttgcgcatgacggctaccatccgatccgacgggaacaggtcattccgaaagatgtcgcg
aaactcgccaaagccctgatgctgacatgcgggatgtacaatgcgtcaggcaaatatgcg
gctttcgtcggcgtcccggccaaaagcggggtatccggcggcattatggcattggttccc
ccaagcgccagaagagaacagccttttcataacggctgcggcatcggcatttacggtccg
gccattgatgaatacggcaacagcctgaccggcggcatgctgctgaaacatatcgcacag
gagtgggagctcagtattttttaa

DBGET integrated database retrieval system