KEGG   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2: BANAU_0954Help
Entry
BANAU_0954        CDS       T02050                                 

Gene name
aprE
Definition
peptidase S8/S53 subtilisin kexin sedolisin (EC:3.4.21.62)
Orthology
K01342  
subtilisin [EC:3.4.21.62]
Organism
bya  Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
Brite
Enzymes [BR:bya01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.62  subtilisin
     BANAU_0954 (aprE)
Peptidases [BR:bya01002]
 Serine Peptidases
  Family S8: subtilisin family
   BANAU_0954 (aprE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1020033..1021181)
Genome map
AA seq 382 aa AA seqDB search
MRGKKVWISLLFALALIFTMAFGSTSPAQAAGKSNGEKKYIVGFKQTMSTMSAAKKKDVI
SEKGGKVQKQFKYVDAASATLNEKAVKELKKDPSVAYVEEDHVAQAYAQSVPYGVSQIKA
PALHSQGFTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETNPFQDNNSHGTHVAGTVA
ALNNSVGVLGVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSA
ALKAAVDKAVASGIVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVNSSNQRASFSSVG
SELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENT
TTKLGDAFYYGKGLINVQAAAQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgagaggcaaaaaggtatggatcagtttgctgtttgctttagcgttaatctttacgatg
gcgttcggcagcacgtctcctgcccaggcggcagggaaatcaaacggggaaaagaaatac
attgtcggatttaaacagacaatgagcacgatgagcgccgctaagaaaaaagatgtcatt
tctgaaaaaggcgggaaagtgcaaaagcaattcaaatatgtagacgcagcttcagctaca
ttaaatgaaaaagctgtaaaagagctgaaaaaagaccctagcgtcgcttacgttgaagaa
gatcacgttgcacaggcgtacgcgcagtccgtgccttacggcgtatcacagattaaagcc
cctgctctgcactctcaaggcttcaccggatcaaatgttaaagtagcggttatcgacagc
ggtatcgattcttctcatcctgatttaaaggtagcaggcggagccagcatggttccttct
gaaacaaatcctttccaagacaacaactctcacggaactcacgttgccggtacagttgcg
gctcttaataactcagtcggtgtattaggcgttgcgccaagcgcatctctttacgctgta
aaagttctcggcgctgacggttccggccagtacagctggatcattaacggaattgagtgg
gcgatcgcaaacaatatggacgttattaacatgagcctcggcggaccttctggttctgca
gcgttaaaagcggcagttgacaaagccgttgcttccggcatcgtagtcgtagcggcagcc
ggtaacgaaggcacttccggcagctcaagcacagtgggctaccctggtaaatacccttct
gtcattgcggtaggggcagttaacagcagcaaccaaagagcatctttctcaagcgtaggt
tctgagcttgatgtcatggcaccaggcgtctctatccaaagcacgcttcctggaaacaaa
tacggcgcgtacaatggtacgtcaatggcatctccgcacgttgccggagcggctgctttg
attctttctaagcacccgaactggacaaacactcaagtccgcagcagtttagaaaacacc
actacaaaacttggtgatgctttctactacggaaaagggctgatcaacgtacaggcggca
gctcagtaa

DBGET integrated database retrieval system