KEGG   Bacillus velezensis YAU B9601-Y2: BANAU_1164Help
Entry
BANAU_1164        CDS       T02050                                 

Gene name
hemD1
Definition
(GenBank) Uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bya  Bacillus velezensis YAU B9601-Y2
Pathway
bya00860  Porphyrin and chlorophyll metabolism
bya01100  Metabolic pathways
bya01110  Biosynthesis of secondary metabolites
bya01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bya00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BANAU_1164 (hemD1)
Enzymes [BR:bya01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BANAU_1164 (hemD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: CCG49185
Position
1226084..1226902
Genome map
AA seq 272 aa AA seqDB search
MGKGLNGKRIAIGGSRKTEEITKLIEKQGGTAVVRSLQGTVYLAEDQIEPDVRTFAGQKA
DWVIFTTGIGTETLLSVSEKIGLKEEFLAAVHEAKIGCRGYKTYAALKKLGITPHASDED
GTTRGLIRSLERFDFKDKKVMIQLHGEKAPVLTEFLEKNGAEVFPVLPYKHIPPERETVD
KLLGELLNGEVDAVCFTTAIQVRSLFDYAKEKGFTKELQQAFEKHVLAAAVGKVTAEAIR
DEGVKRVLAPDIERMGAMIIELSRYYESLTLS
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaggattgaacgggaaacggattgccatcggcggttcgcggaaaacagaagag
atcacaaaattaatagaaaagcagggcggaacggcagtcgtccgttccctccaaggaacc
gtatacctggcggaggatcaaattgaacccgacgtaagaacatttgccgggcaaaaagcc
gactgggtgatattcaccacaggcatcggtacggaaacgttattgtcggtatcggaaaaa
atcggtctgaaagaagaatttttagcggccgttcatgaagcgaaaatcggctgcagaggc
tataaaacatatgcggccttaaaaaagctcggcatcacgccgcatgcctcagatgaagac
ggtacaacaagagggctgatccgctccttggaacgatttgactttaaagataaaaaagtc
atgatacagcttcatggcgaaaaagcgccggtcttaacggagttccttgagaaaaacgga
gcggaggttttccctgttctgccgtataagcatattccgcctgaaagggagacggtcgat
aaactgctgggagagctgttaaacggagaggtcgatgccgtatgttttacgacagccatt
caagtgcgctctctctttgattatgcaaaagaaaaagggttcacaaaagaattgcagcag
gcattcgaaaaacatgtgcttgccgccgcagtcggcaaagtgacggctgaagcgatccgg
gatgaaggggtaaagagggtccttgctccggacattgagcggatgggagcgatgattatt
gaattatcccgttactatgaatctctgaccttgtcataa

DBGET integrated database retrieval system