KEGG   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2: BANAU_1229Help
Entry
BANAU_1229        CDS       T02050                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
bya  Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bya00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BANAU_1229 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BANAU_1229 (proB)
Enzymes [BR:bya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BANAU_1229 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1280525..1281640
Genome map
AA seq 371 aa AA seqDB search
MMKKQRIVVKIGSSSLTNSNGSIDEAKIKEHTEAISLLKENGHEVILITSGAVAAGFSAL
GYPSRPVTIKGKQAAAAVGQTLLMQQYMDHLKRYGLTPAQILLTRNDFSKRERYRNAYAT
VMELLERGVVPIINENDSTSVEELTFGDNDMLSALVSGLIHADQLMILTDINGLYDANPN
ENPDANRFDYLNDITPELLGYAGSAGSKVGTGGMKSKLLAAQTALSLGVKVFIGTGSGRE
KLMGILDGKGDGTYIGDKDLSSVNNTRQWIMFHSPISGEIIIDGGAEQAMIHNGSSLLPA
GVADVCGSFPKGAVVEVRGPGGIIGKGQTQYSSDEILEAKGKRSDQLSGTKQVEVIHRDD
WVNLFDEGEHK
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaaaacaaagaattgttgtgaaaatcgggagcagctcgctcaccaacagtaac
ggaagtattgatgaagcaaaaatcaaggaacatacggaagccatttctttattaaaagaa
aacgggcatgaagtgatcctcattacctcaggcgcggtggcagcgggtttttccgctctc
ggctatccgtcgcgacccgttacgataaaaggaaagcaggccgctgccgcagtcggccag
acgcttttaatgcagcaatatatggaccatttaaaaagatacggtctgacgccggcacaa
attttattaacaagaaatgatttctcaaaaagagagcggtacagaaatgcctatgccact
gtaatggaactgttggagcgtggcgtcgtgccgattattaacgagaatgattccacatca
gtcgaagagctgacgttcggtgataacgacatgctgtcggcgcttgtgagcgggttgatt
catgcagaccaattaatgattctcacagacattaacgggctgtacgatgccaatccgaat
gaaaacccggacgcaaatcggttcgactatctgaatgacattacgccagaattgctcggg
tatgccggatcagcaggctcaaaggtcggcaccggaggcatgaagtcaaaacttctcgcc
gcccagaccgcattgtcgctcggggtgaaggtatttatcggaaccggctccggacgggaa
aaactgatgggaattttagacggaaaaggcgacggcacttatatcggcgataaagacctg
tcctcagtgaataatacacggcaatggatcatgtttcattctccgatatcaggggaaatc
atcattgatgggggagcggagcaggcgatgatccataacgggtcaagtctcctcccggcc
ggtgtcgccgatgtctgcggcagttttccgaaaggggctgtagtggaagtcagagggccc
ggcggcattatcggcaaagggcagacgcagtactcatccgatgaaattttagaagccaaa
gggaagcggagcgaccagctttcaggaacgaagcaggtggaagtgattcacagagatgat
tgggtgaatttatttgacgagggggaacacaaatga

DBGET integrated database retrieval system