KEGG   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2: BANAU_1276Help
Entry
BANAU_1276        CDS       T02050                                 

Gene name
mtnZ
Definition
1,2-dihydroxy-3-keto-5-methylthiopentenedioxygenase (EC:1.13.11.54)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
bya  Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:bya00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1328091..1328627
Genome map
AA seq 178 aa AA seqDB search
MATIRIHDEKNTIIEHQEEVARFLDEQEVIYEQWNIEKLPSELSEKYDLTEDEKERILAA
FDTEIQDISARRGYQSQDVIYLSDTTPNLDELLKNFQREHHHTDDEVRFIVSGHGIFVIQ
GKDGTFFDVRLNPGDLISVPENIRHYFTLQEDRRVVAIRIFVTTEGWVPIYENESVQN
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccatcagaattcatgacgaaaaaaatacgatcattgaacatcaggaagaagta
gcgcgcttcttagatgaacaagaggtgatctatgagcagtggaacattgaaaaacttccg
tctgagctttcggaaaaatacgatctaactgaagatgaaaaagaacggattctcgcggcg
tttgacacggagattcaggacatttcagcccggcgcggatatcagtctcaggatgtcatt
tatttatcagataccacgccgaatcttgatgaattattaaaaaatttccaaagagaacat
caccacacggatgatgaagtccgctttatcgtcagcggacacggcatcttcgtcattcaa
ggcaaagacggcacatttttcgacgtccgtttaaatccgggagatttgatttcagttccg
gagaacatccgccactactttacgcttcaggaagaccgccgggtcgtcgcaatccggatc
tttgtgacgactgagggctgggtgccgatttacgaaaatgaaagtgtgcaaaactga

DBGET integrated database retrieval system