KEGG   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2: BANAU_1276Help
Entry
BANAU_1276        CDS       T02050                                 

Gene name
mtnZ
Definition
1,2-dihydroxy-3-keto-5-methylthiopentenedioxygenase (EC:1.13.11.54)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
bya  Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bya00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BANAU_1276 (mtnZ)
Enzymes [BR:bya01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     BANAU_1276 (mtnZ)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     BANAU_1276 (mtnZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1328091..1328627
Genome map
AA seq 178 aa AA seqDB search
MATIRIHDEKNTIIEHQEEVARFLDEQEVIYEQWNIEKLPSELSEKYDLTEDEKERILAA
FDTEIQDISARRGYQSQDVIYLSDTTPNLDELLKNFQREHHHTDDEVRFIVSGHGIFVIQ
GKDGTFFDVRLNPGDLISVPENIRHYFTLQEDRRVVAIRIFVTTEGWVPIYENESVQN
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccatcagaattcatgacgaaaaaaatacgatcattgaacatcaggaagaagta
gcgcgcttcttagatgaacaagaggtgatctatgagcagtggaacattgaaaaacttccg
tctgagctttcggaaaaatacgatctaactgaagatgaaaaagaacggattctcgcggcg
tttgacacggagattcaggacatttcagcccggcgcggatatcagtctcaggatgtcatt
tatttatcagataccacgccgaatcttgatgaattattaaaaaatttccaaagagaacat
caccacacggatgatgaagtccgctttatcgtcagcggacacggcatcttcgtcattcaa
ggcaaagacggcacatttttcgacgtccgtttaaatccgggagatttgatttcagttccg
gagaacatccgccactactttacgcttcaggaagaccgccgggtcgtcgcaatccggatc
tttgtgacgactgagggctgggtgccgatttacgaaaatgaaagtgtgcaaaactga

DBGET integrated database retrieval system