KEGG   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2: BANAU_1437Help
Entry
BANAU_1437        CDS       T02050                                 

Gene name
ylaM2
Definition
glutaminase YlaM (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bya  Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bya00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BANAU_1437 (ylaM2)
   00330 Arginine and proline metabolism
    BANAU_1437 (ylaM2)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BANAU_1437 (ylaM2)
Enzymes [BR:bya01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     BANAU_1437 (ylaM2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1535332..1536012
Genome map
AA seq 226 aa AA seqDB search
MKKVMFIPLTGDPFNSMIKLETVNPGKPLNPMINAGALVVTGLIKGHSPKDRLNYLLGFI
RRLANNQDITYCSHVAESEFKSSMINRAMCYYMKQYDIFKGDVEEVMDLYTKQCAIKMSS
LDLAKIGCVFALDGKHPETGEQVIKKDVARICKTFMVTCGMYNASGEFAIKVGIPAKSGV
SGGIMGISPYNFGIGIFGPALDEKGNSIAGVKLLEIMSEKYRLSIF
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttatgttcattccattaaccggcgacccgtttaattccatgattaagctt
gaaacagtaaatccgggcaagcctttaaatccgatgattaatgcgggagctctcgtcgtt
acgggtttaattaaagggcattcgccgaaagaccgcctgaattacctgctcggattcatc
agaagacttgcgaataatcaggacattacatattgcagccatgtcgcggaatcggaattc
aaatcttccatgattaatcgggccatgtgttattacatgaagcagtatgacatttttaaa
ggcgatgttgaagaggtcatggatttgtatacaaaacagtgcgcgattaagatgagcagt
ctggatttagccaaaatcggctgtgtattcgcccttgacggcaagcatccggaaaccggg
gagcaggtcattaaaaaagatgtggcgagaatctgcaagacgtttatggtgacctgcggc
atgtacaatgcgagcggggaattcgcaatcaaggtcggcattcccgctaaaagcggcgtt
tcgggaggaatcatgggtatttcgccgtacaacttcggaatcggtatattcggcccggcg
cttgatgaaaaaggcaacagcatcgcgggtgtgaagcttttggaaatcatgtctgagaaa
tacaggctgagtattttttga

DBGET integrated database retrieval system