KEGG   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2: BANAU_1520Help
Entry
BANAU_1520        CDS       T02050                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bya  Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bya00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1623957..1624571
Genome map
AA seq 204 aa AA seqDB search
MKERGLLIVLSGPSGVGKGTVRQAIFSQQDTKFEYSISVTTRNPREGEVDGVDYFFKSRD
EFERMIENNKLLEWAEYVGNYYGTPVDYVEQTLQEGKDVFLEIEVQGALQVRNAFPEGLF
IFLAPPSLSELKNRIVTRGTETDDLIENRMNAAKAEIEMMDAYDYVVENDDIQTACDKIN
AIVLAEHLKRERVAPRYKKMLEVE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaagagggttattaatcgttctctcaggtccctccggagttggaaaaggaacg
gttcggcaagcaatattttcacaacaggacacgaaatttgaatactcaatttcagtcacg
acgagaaacccgagagagggcgaggtcgacggcgtcgattatttctttaaatcaagagat
gaattcgaacgcatgattgaaaacaacaaactgcttgagtgggcggaatatgtcggcaac
tattacggaacgcccgttgattatgtcgaacagacgcttcaagaaggaaaagacgtcttc
ttagagattgaagtgcagggcgcgctccaagtgcgtaatgcatttccggaaggcctgttt
atcttcttagcgccgccgagtctttctgagctgaaaaacagaatcgtgacaagagggact
gaaaccgacgatttaatcgaaaacagaatgaatgccgcaaaagctgaaatcgaaatgatg
gacgcgtatgattatgtcgttgaaaacgacgatatccaaacggcttgtgataagattaac
gcaatcgttctcgccgagcacttaaaacgtgaacgcgtcgctccgagatataagaaaatg
ctggaggtagaataa

DBGET integrated database retrieval system